Review



deconvolution software mass hunter unknown analysis 7.0  (Agilent technologies)


Bioz Verified Symbol Agilent technologies is a verified supplier
Bioz Manufacturer Symbol Agilent technologies manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 90
      Buy from Supplier

    Structured Review

    Agilent technologies deconvolution software mass hunter unknown analysis 7.0
    Deconvolution Software Mass Hunter Unknown Analysis 7.0, supplied by Agilent technologies, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/pm37511506-256-3-5
    Average 90 stars, based on 1 article reviews
    deconvolution software mass hunter unknown analysis 7.0 - by Bioz Stars, 2026-10
    90/100 stars

    Images

    Related Articles

    Software:

    Article Title: Prokineticin 1 receptor antagonists
    Article Snippet: .. Masses of eluting components were calculated using the Agilent deconvolution software. .. Masses of eluting components were calculated using the Agilent deconvolution software.

    Article Title: Prokineticin 1 receptor antagonists
    Article Snippet: .. Masses of eluting components were calculated using the Agilent deconvolution software. ..

    Article Title: Coupling Environmental Whole Mixture Toxicity Screening with Unbiased RNA-Seq Reveals Site-Specific Biological Responses in Zebrafish
    Article Snippet: .. Detected chemicals were identified via their mass spectra using Agilent Deconvolution Reporting Software developed by Agilent utilizing the AMDIS spectral database [ ]. ..

    Article Title: NanoLC-EI-MS: Perspectives in Biochemical Analysis.
    Article Snippet: .. However, by employing deconvolution software (Agilent Mass Hunter Unknown Analysis 7.0), a distinct signal emerged beneath a prominent matrix peak, conclusively identified as benzo[a]pyrene (Figure 3). ..

    Article Title: Methods of modulating intestine epithelial functions
    Article Snippet: The filtrate was stored in a filtrate bottle at 4° C. The PK1 peptide containing media was purified by gravity flow passage of media over M2 agarose columns (Sigma Chemical, St. Louis, Mo.) .. Masses of eluting components were calculated using the Agilent deconvolution software. ..

    Article Title: Silicone passive sampling used to identify novel dermal chemical exposures of firefighters and assess PPE innovations.
    Article Snippet: .. The analysis relies on an automated mass spectral deconvolution and identification system (AMDIS v. 2.66, National Institute of Standards and Technology) and deconvolution reporting software (DRS, Agilent) (Bergmann et al., 2018). ..

    Article Title: Amino-heteroaryl-containing prokineticin 1 receptor antagonists
    Article Snippet: .. Masses of eluting components were calculated using the Agilent deconvolution software. .. Recombinant N-terminal FLAG-tagged human prokineticin-1 (sequence-MRGATRVSIMLLLVTVSDCDYKDDDDKAVITGACERDVQCGAGTCCAISLWL RGLRMCTPLGREGEECHPGSHKVPFFRKRKHHTCPCLPNLLCSRFPDGRYR CSMDLKNINF) was expressed in stably transfected HEK 293 cells.



    Similar Products

    data analysis software with maxent deconvolution  (Bruker Corporation)
    90
    Bruker Corporation data analysis software with maxent deconvolution
    Data Analysis Software With Maxent Deconvolution, supplied by Bruker Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/maxent+deconvolution+software+tools/10__1107_slash_s2059798325005297-94-14-9
    Average 90 stars, based on 1 article reviews
    data analysis software with maxent deconvolution - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    elements ar analysis 2 d deconvolution software  (Nikon)
    99
    Nikon elements ar analysis 2 d deconvolution software
    Elements Ar Analysis 2 D Deconvolution Software, supplied by Nikon, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/NIS-Elements/pmc11484838-122-14-13
    Average 99 stars, based on 1 article reviews
    elements ar analysis 2 d deconvolution software - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    deconvolution analysis  (Olympus)
    99
    Olympus deconvolution analysis
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Deconvolution Analysis, supplied by Olympus, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/cellSens+Imaging+Software/pmc11261793-400-20-25
    Average 99 stars, based on 1 article reviews
    deconvolution analysis - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    pixel-by-pixel deconvolution analysis with a home-written plugin for visage 7 software  (Visage Imaging GmbH)
    90
    Visage Imaging GmbH pixel-by-pixel deconvolution analysis with a home-written plugin for visage 7 software
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Pixel By Pixel Deconvolution Analysis With A Home Written Plugin For Visage 7 Software, supplied by Visage Imaging GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/pixel+by+pixel+deconvolution+analysis+with+a+home+written+plugin+for+visage+7+software/pmc11399308__330_2024_10669_MOESM1_ESM-21-23-28
    Average 90 stars, based on 1 article reviews
    pixel-by-pixel deconvolution analysis with a home-written plugin for visage 7 software - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    deconvolution software mass hunter unknown analysis 7.0  (Agilent technologies)
    90
    Agilent technologies deconvolution software mass hunter unknown analysis 7.0
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Deconvolution Software Mass Hunter Unknown Analysis 7.0, supplied by Agilent technologies, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/pm37511506-256-3-5
    Average 90 stars, based on 1 article reviews
    deconvolution software mass hunter unknown analysis 7.0 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    deconvolution fit analysis software fls980  (Edinburgh Instruments)
    90
    Edinburgh Instruments deconvolution fit analysis software fls980
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Deconvolution Fit Analysis Software Fls980, supplied by Edinburgh Instruments, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/fs5+spectrofluorometer/pm36420868-112-0-5
    Average 90 stars, based on 1 article reviews
    deconvolution fit analysis software fls980 - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    deconvolution analysis software sound analysis  (Quantum Northwest)
    90
    Quantum Northwest deconvolution analysis software sound analysis
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Deconvolution Analysis Software Sound Analysis, supplied by Quantum Northwest, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/deconvolution+analysis+software+sound+analysis/pm35266706-201-1-7
    Average 90 stars, based on 1 article reviews
    deconvolution analysis software sound analysis - by Bioz Stars, 2026-10
    90/100 stars
    		  Buy from Supplier
    olympus 3d deconvolution software  (Evident Corporation)
    93
    Evident Corporation olympus 3d deconvolution software
    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , <t>deconvolution</t> analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.
    Olympus 3d Deconvolution Software, supplied by Evident Corporation, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/deconvolution+software+analysis/pm35140211-335-0-0
    Average 93 stars, based on 1 article reviews
    olympus 3d deconvolution software - by Bioz Stars, 2026-10
    93/100 stars
    		  Buy from Supplier

    Image Search Results


    Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , deconvolution analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.

    Journal: The Journal of Biological Chemistry

    Article Title: Multi-modal mechanisms of the metastasis suppressor, NDRG1: Inhibition of WNT/β-catenin signaling by stabilization of protein kinase Cα

    doi: 10.1016/j.jbc.2024.107417

    Figure Lengend Snippet: Triple co-localization of β-catenin, NDRG1, and PKCα demonstrates the formation of a possible metabolon, decreasing β-catenin levels and nuclear localization. A – H , NDRG1 overexpression in PANC-1 cells significantly increases the co-localization between β-catenin, NDRG1, and PKCα. A and B , VC and NDRG1 overexpressing PANC-1 cells were incubated for 24 h/37 °C in the presence and absence of WNT3a (100 ng/ml). The cells were then examined for β-catenin ( green ), NDRG1 ( red ), and PKCα ( blue ) expression and triple co-localization ( white ) using confocal immunofluorescence microscopy. Studies were performed using a 100× objective at the same acquisition setting with Olympus Fluoview FV3000 software. Images were digitally magnified for better demonstration of the possible co-localization. The scale bar = 3 μm for all images except for the inset images, where the scale bar = 9 μm. C and D , deconvolution analysis was then implemented on the images in ( A and B ) using Olympus CellSens imaging software. White arrows demonstrate triple co-localization and possible formation of the metabolon. The scale bar = 3 μm for all deconvolution images except for the inset images, where the scale bar = 1.8 μm. In all studies, the images are representative of three experiments, and the quantitative analysis of the pixel intensities is shown for ( E ) β-catenin; ( F ) NDRG1; ( G ) PKCα; and ( H ) Co-localization between β-catenin, NDRG1, and PKCα. Quantitative analyses were performed using ImageJ software and were presented as the mean ± SD ( n = 3). Analysis of pixel intensity and co-localization were performed using 24 cells. Statistical significance is denoted as ∗∗ p < 0.01 and ∗∗∗ p < 0.001 comparing NDRG1 overexpressing PANC-1 cells in the presence and absence of WNT3a to VC cells in the absence of WNT3a; or ### p < 0.001 comparing NDRG1 overexpressing PANC-1 cells to VC cells in the presence of WNT3a.

    Article Snippet: The images of visualized cells were then examined using Olympus Fluoview software, and in some studies, images were processed for deconvolution analysis with CellSens software (Olympus) to improve contrast and image resolution.

    Techniques: Over Expression, Incubation, Expressing, Immunofluorescence, Microscopy, Software, Imaging