ucb Search Results


  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 89
    UCB SA certolizumab pegol
    Certolizumab Pegol, supplied by UCB SA, used in various techniques. Bioz Stars score: 89/100, based on 37 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/certolizumab pegol/product/UCB SA
    Average 89 stars, based on 37 article reviews
    Price from $9.99 to $1999.99
    certolizumab pegol - by Bioz Stars, 2020-09
    89/100 stars
      Buy from Supplier

    88
    UCB SA union chimique belge ucb
    Union Chimique Belge Ucb, supplied by UCB SA, used in various techniques. Bioz Stars score: 88/100, based on 30 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/union chimique belge ucb/product/UCB SA
    Average 88 stars, based on 30 article reviews
    Price from $9.99 to $1999.99
    union chimique belge ucb - by Bioz Stars, 2020-09
    88/100 stars
      Buy from Supplier

    91
    UCB SA levetiracetam
    The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and <t>levetiracetam</t> (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (16 mg kg −1 h −1 ; n =6 per group).
    Levetiracetam, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 21 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/levetiracetam/product/UCB SA
    Average 91 stars, based on 21 article reviews
    Price from $9.99 to $1999.99
    levetiracetam - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    msd  (UCB SA)
    92
    UCB SA msd
    The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and <t>levetiracetam</t> (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (16 mg kg −1 h −1 ; n =6 per group).
    Msd, supplied by UCB SA, used in various techniques. Bioz Stars score: 92/100, based on 15 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/msd/product/UCB SA
    Average 92 stars, based on 15 article reviews
    Price from $9.99 to $1999.99
    msd - by Bioz Stars, 2020-09
    92/100 stars
      Buy from Supplier

    88
    UCB SA metadate cd
    Mean simulated concentration-time profiles for multilayer extended-release bead <t>methylphenidate</t> (MPH-MLR) dose strengths between 10 mg and 80 mg.
    Metadate Cd, supplied by UCB SA, used in various techniques. Bioz Stars score: 88/100, based on 11 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/metadate cd/product/UCB SA
    Average 88 stars, based on 11 article reviews
    Price from $9.99 to $1999.99
    metadate cd - by Bioz Stars, 2020-09
    88/100 stars
      Buy from Supplier

    97
    UCB SA czp pfp
    Key features of the <t>CZP</t> <t>PFP.</t> CZP certolizumab pegol, PFP pre-filled pen
    Czp Pfp, supplied by UCB SA, used in various techniques. Bioz Stars score: 97/100, based on 10 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/czp pfp/product/UCB SA
    Average 97 stars, based on 10 article reviews
    Price from $9.99 to $1999.99
    czp pfp - by Bioz Stars, 2020-09
    97/100 stars
      Buy from Supplier

    91
    UCB SA pharmacoepidemiology
    Key features of the <t>CZP</t> <t>PFP.</t> CZP certolizumab pegol, PFP pre-filled pen
    Pharmacoepidemiology, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/pharmacoepidemiology/product/UCB SA
    Average 91 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    pharmacoepidemiology - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    ucb  (UCB SA)
    92
    UCB SA ucb
    Key features of the <t>CZP</t> <t>PFP.</t> CZP certolizumab pegol, PFP pre-filled pen
    Ucb, supplied by UCB SA, used in various techniques. Bioz Stars score: 92/100, based on 10 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ucb/product/UCB SA
    Average 92 stars, based on 10 article reviews
    Price from $9.99 to $1999.99
    ucb - by Bioz Stars, 2020-09
    92/100 stars
      Buy from Supplier

    88
    UCB SA certolizumab
    Associations of Industry Payments With Prescriptions for Biologic Medications Total payments received by each physician are plotted on the horizontal axis, while total cost associated with prescriptions written by each physician is plotted on the vertical axis. A, Association of industry payments with prescription numbers for 3737 physicians prescribing adalimumab. B, Association of industry payments with prescription numbers for 621 physicians prescribing <t>certolizumab.</t>
    Certolizumab, supplied by UCB SA, used in various techniques. Bioz Stars score: 88/100, based on 9 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/certolizumab/product/UCB SA
    Average 88 stars, based on 9 article reviews
    Price from $9.99 to $1999.99
    certolizumab - by Bioz Stars, 2020-09
    88/100 stars
      Buy from Supplier

    91
    UCB SA lacosamide
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Lacosamide, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 7 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/lacosamide/product/UCB SA
    Average 91 stars, based on 7 article reviews
    Price from $9.99 to $1999.99
    lacosamide - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    85
    UCB SA ucb s a pharma sector
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Ucb S A Pharma Sector, supplied by UCB SA, used in various techniques. Bioz Stars score: 85/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/ucb s a pharma sector/product/UCB SA
    Average 85 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    ucb s a pharma sector - by Bioz Stars, 2020-09
    85/100 stars
      Buy from Supplier

    91
    UCB SA levetiracetam tablets
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Levetiracetam Tablets, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/levetiracetam tablets/product/UCB SA
    Average 91 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    levetiracetam tablets - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    91
    UCB SA akebia
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Akebia, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/akebia/product/UCB SA
    Average 91 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    akebia - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    89
    UCB SA human prolactin
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Human Prolactin, supplied by UCB SA, used in various techniques. Bioz Stars score: 89/100, based on 41 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human prolactin/product/UCB SA
    Average 89 stars, based on 41 article reviews
    Price from $9.99 to $1999.99
    human prolactin - by Bioz Stars, 2020-09
    89/100 stars
      Buy from Supplier

    91
    UCB SA urokinase vedim 250000 ui vial
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Urokinase Vedim 250000 Ui Vial, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 15 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/urokinase vedim 250000 ui vial/product/UCB SA
    Average 91 stars, based on 15 article reviews
    Price from $9.99 to $1999.99
    urokinase vedim 250000 ui vial - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    90
    UCB SA direction générale de la sante
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Direction Générale De La Sante, supplied by UCB SA, used in various techniques. Bioz Stars score: 90/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/direction générale de la sante/product/UCB SA
    Average 90 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    direction générale de la sante - by Bioz Stars, 2020-09
    90/100 stars
      Buy from Supplier

    efa  (UCB SA)
    92
    UCB SA efa
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Efa, supplied by UCB SA, used in various techniques. Bioz Stars score: 92/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/efa/product/UCB SA
    Average 92 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    efa - by Bioz Stars, 2020-09
    92/100 stars
      Buy from Supplier

    nyu  (UCB SA)
    90
    UCB SA nyu
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Nyu, supplied by UCB SA, used in various techniques. Bioz Stars score: 90/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/nyu/product/UCB SA
    Average 90 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    nyu - by Bioz Stars, 2020-09
    90/100 stars
      Buy from Supplier

    85
    UCB SA apl lys 262 ala 207
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Apl Lys 262 Ala 207, supplied by UCB SA, used in various techniques. Bioz Stars score: 85/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/apl lys 262 ala 207/product/UCB SA
    Average 85 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    apl lys 262 ala 207 - by Bioz Stars, 2020-09
    85/100 stars
      Buy from Supplier

    85
    UCB SA apl vivklipstssavdtpyldityhfvaqrlpl
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Apl Vivklipstssavdtpyldityhfvaqrlpl, supplied by UCB SA, used in various techniques. Bioz Stars score: 85/100, based on 4 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/apl vivklipstssavdtpyldityhfvaqrlpl/product/UCB SA
    Average 85 stars, based on 4 article reviews
    Price from $9.99 to $1999.99
    apl vivklipstssavdtpyldityhfvaqrlpl - by Bioz Stars, 2020-09
    85/100 stars
      Buy from Supplier

    85
    UCB SA anti human prolactin antiserum
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Anti Human Prolactin Antiserum, supplied by UCB SA, used in various techniques. Bioz Stars score: 85/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/anti human prolactin antiserum/product/UCB SA
    Average 85 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    anti human prolactin antiserum - by Bioz Stars, 2020-09
    85/100 stars
      Buy from Supplier

    grb  (UCB SA)
    90
    UCB SA grb
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Grb, supplied by UCB SA, used in various techniques. Bioz Stars score: 90/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/grb/product/UCB SA
    Average 90 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    grb - by Bioz Stars, 2020-09
    90/100 stars
      Buy from Supplier

    bmbf  (UCB SA)
    92
    UCB SA bmbf
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Bmbf, supplied by UCB SA, used in various techniques. Bioz Stars score: 92/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/bmbf/product/UCB SA
    Average 92 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    bmbf - by Bioz Stars, 2020-09
    92/100 stars
      Buy from Supplier

    91
    UCB SA braine l alleud
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Braine L Alleud, supplied by UCB SA, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/braine l alleud/product/UCB SA
    Average 91 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    braine l alleud - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    90
    UCB SA brivaracetam
    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, <t>lacosamide;</t> DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.
    Brivaracetam, supplied by UCB SA, used in various techniques. Bioz Stars score: 90/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/brivaracetam/product/UCB SA
    Average 90 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    brivaracetam - by Bioz Stars, 2020-09
    90/100 stars
      Buy from Supplier

    Image Search Results


    The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and levetiracetam (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (16 mg kg −1 h −1 ; n =6 per group).

    Journal: British Journal of Pharmacology

    Article Title: A comparison of the efficacy of carbamazepine and the novel anti-epileptic drug levetiracetam in the tetanus toxin model of focal complex partial epilepsy

    doi: 10.1038/sj.bjp.0704606

    Figure Lengend Snippet: The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and levetiracetam (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (16 mg kg −1 h −1 ; n =6 per group).

    Article Snippet: Five to seven days after the onset of the tetanus toxin induced seizure syndrome, rats were re-anaesthetized, as described above, and an Alzet osmotic minipump (Charles River, U.K.) containing carbamazepine ( n =6; Sigma, Poole, Dorset, U.K.), constituted in DMSO, propylene glycol and ethyl alcohol (42.5 : 42.5 : 15, v : v : v), or levetiracetam ( n =6; UCB SA, Chemin du Foriest, Belgium), constituted in saline, was placed in the peritoneal cavity.

    Techniques: Concentration Assay

    Anticonvulsant effect of levetiracetam

    Journal: British Journal of Pharmacology

    Article Title: A comparison of the efficacy of carbamazepine and the novel anti-epileptic drug levetiracetam in the tetanus toxin model of focal complex partial epilepsy

    doi: 10.1038/sj.bjp.0704606

    Figure Lengend Snippet: Anticonvulsant effect of levetiracetam

    Article Snippet: Five to seven days after the onset of the tetanus toxin induced seizure syndrome, rats were re-anaesthetized, as described above, and an Alzet osmotic minipump (Charles River, U.K.) containing carbamazepine ( n =6; Sigma, Poole, Dorset, U.K.), constituted in DMSO, propylene glycol and ethyl alcohol (42.5 : 42.5 : 15, v : v : v), or levetiracetam ( n =6; UCB SA, Chemin du Foriest, Belgium), constituted in saline, was placed in the peritoneal cavity.

    Techniques:

    The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and levetiracetam (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (8 mg kg −1 h −1 ; n =6 per group).

    Journal: British Journal of Pharmacology

    Article Title: A comparison of the efficacy of carbamazepine and the novel anti-epileptic drug levetiracetam in the tetanus toxin model of focal complex partial epilepsy

    doi: 10.1038/sj.bjp.0704606

    Figure Lengend Snippet: The temporal relationship between the daily median number (±IQR) of generalized (A) and non-generalized (B) seizures in control (shaded) and levetiracetam (non-shaded) treated rats and levetiracetam concentration in serum and cerebrospinal fluid (CSF) in levetiracetam administrated rats (8 mg kg −1 h −1 ; n =6 per group).

    Article Snippet: Five to seven days after the onset of the tetanus toxin induced seizure syndrome, rats were re-anaesthetized, as described above, and an Alzet osmotic minipump (Charles River, U.K.) containing carbamazepine ( n =6; Sigma, Poole, Dorset, U.K.), constituted in DMSO, propylene glycol and ethyl alcohol (42.5 : 42.5 : 15, v : v : v), or levetiracetam ( n =6; UCB SA, Chemin du Foriest, Belgium), constituted in saline, was placed in the peritoneal cavity.

    Techniques: Concentration Assay

    Mean simulated concentration-time profiles for multilayer extended-release bead methylphenidate (MPH-MLR) dose strengths between 10 mg and 80 mg.

    Journal: Journal of Child and Adolescent Psychopharmacology

    Article Title: Single-Dose Pharmacokinetics of Methylphenidate Extended-Release Multiple Layer Beads Administered as Intact Capsule or Sprinkles Versus Methylphenidate Immediate-Release Tablets (Ritalin®) in Healthy Adult Volunteers

    doi: 10.1089/cap.2013.0135

    Figure Lengend Snippet: Mean simulated concentration-time profiles for multilayer extended-release bead methylphenidate (MPH-MLR) dose strengths between 10 mg and 80 mg.

    Article Snippet: The IR component of the total MPH dose of current second-generation ER formulations differs (20%, Quillivant XR™, NextWave Pharmaceuticals, Cupertino CA; 22%, Concerta® , Janssen Pharmaceuticals, Inc., Titusville, NJ; 30%, Metadate® CD, UCB, Inc., Smyrna, GA; 50%, Ritalin LA, Novartis Pharmaceuticals Corporation, East Hanover, NJ; and 50% [dexmethylphenidate] Focalin XR® , Novartis Pharmaceuticals Corporation, East Hanover, NJ) (Markowitz et al. ; Quillivant XR [methylphenidate hydrochloride] product information ).

    Techniques: Concentration Assay

    Study design. Sequence 1: Multilayer extended-release bead methylphenidate (MPH-MLR) 80 mg capsule once daily (period 1); MPH-MLR 80 mg sprinkles once daily (period 2); and Ritalin ® 25 mg three times daily (period 3). Sequence

    Journal: Journal of Child and Adolescent Psychopharmacology

    Article Title: Single-Dose Pharmacokinetics of Methylphenidate Extended-Release Multiple Layer Beads Administered as Intact Capsule or Sprinkles Versus Methylphenidate Immediate-Release Tablets (Ritalin®) in Healthy Adult Volunteers

    doi: 10.1089/cap.2013.0135

    Figure Lengend Snippet: Study design. Sequence 1: Multilayer extended-release bead methylphenidate (MPH-MLR) 80 mg capsule once daily (period 1); MPH-MLR 80 mg sprinkles once daily (period 2); and Ritalin ® 25 mg three times daily (period 3). Sequence

    Article Snippet: The IR component of the total MPH dose of current second-generation ER formulations differs (20%, Quillivant XR™, NextWave Pharmaceuticals, Cupertino CA; 22%, Concerta® , Janssen Pharmaceuticals, Inc., Titusville, NJ; 30%, Metadate® CD, UCB, Inc., Smyrna, GA; 50%, Ritalin LA, Novartis Pharmaceuticals Corporation, East Hanover, NJ; and 50% [dexmethylphenidate] Focalin XR® , Novartis Pharmaceuticals Corporation, East Hanover, NJ) (Markowitz et al. ; Quillivant XR [methylphenidate hydrochloride] product information ).

    Techniques: Sequencing

    (A) Mean plasma methylphenidate concentration-time profiles following single-dose administration of multilayer extended-release bead methylphenidate (MPH-MLR) 80 mg capsule, MPH-MLR 80 mg sprinkles, and Ritalin ® 25 mg three

    Journal: Journal of Child and Adolescent Psychopharmacology

    Article Title: Single-Dose Pharmacokinetics of Methylphenidate Extended-Release Multiple Layer Beads Administered as Intact Capsule or Sprinkles Versus Methylphenidate Immediate-Release Tablets (Ritalin®) in Healthy Adult Volunteers

    doi: 10.1089/cap.2013.0135

    Figure Lengend Snippet: (A) Mean plasma methylphenidate concentration-time profiles following single-dose administration of multilayer extended-release bead methylphenidate (MPH-MLR) 80 mg capsule, MPH-MLR 80 mg sprinkles, and Ritalin ® 25 mg three

    Article Snippet: The IR component of the total MPH dose of current second-generation ER formulations differs (20%, Quillivant XR™, NextWave Pharmaceuticals, Cupertino CA; 22%, Concerta® , Janssen Pharmaceuticals, Inc., Titusville, NJ; 30%, Metadate® CD, UCB, Inc., Smyrna, GA; 50%, Ritalin LA, Novartis Pharmaceuticals Corporation, East Hanover, NJ; and 50% [dexmethylphenidate] Focalin XR® , Novartis Pharmaceuticals Corporation, East Hanover, NJ) (Markowitz et al. ; Quillivant XR [methylphenidate hydrochloride] product information ).

    Techniques: Concentration Assay

    Key features of the CZP PFP. CZP certolizumab pegol, PFP pre-filled pen

    Journal: Advances in Therapy

    Article Title: Patient Satisfaction with CIMZIA® (Certolizumab Pegol) AutoClicks® in the UK

    doi: 10.1007/s12325-020-01257-6

    Figure Lengend Snippet: Key features of the CZP PFP. CZP certolizumab pegol, PFP pre-filled pen

    Article Snippet: Finally, the longitudinal cohort (patients completing all three visits) included only 79 patients and may not be representative of the entire population of patients using CZP PFP.

    Techniques:

    Associations of Industry Payments With Prescriptions for Biologic Medications Total payments received by each physician are plotted on the horizontal axis, while total cost associated with prescriptions written by each physician is plotted on the vertical axis. A, Association of industry payments with prescription numbers for 3737 physicians prescribing adalimumab. B, Association of industry payments with prescription numbers for 621 physicians prescribing certolizumab.

    Journal: JAMA Internal Medicine

    Article Title: Association of Biologic Prescribing for Inflammatory Bowel Disease With Industry Payments to Physicians

    doi: 10.1001/jamainternmed.2019.0999

    Figure Lengend Snippet: Associations of Industry Payments With Prescriptions for Biologic Medications Total payments received by each physician are plotted on the horizontal axis, while total cost associated with prescriptions written by each physician is plotted on the vertical axis. A, Association of industry payments with prescription numbers for 3737 physicians prescribing adalimumab. B, Association of industry payments with prescription numbers for 621 physicians prescribing certolizumab.

    Article Snippet: The US Food and Drug Administration (FDA) approved adalimumab (Humira, AbbVie Inc) for Crohn disease (CD) in 2007 and ulcerative colitis (UC) in 2012 and approved certolizumab (Cimzia, Union Chimique Belge) for CD in 2006.

    Techniques:

    Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.

    Journal: Frontiers in Neurology

    Article Title: Lacosamide and Levetiracetam Have No Effect on Sharp-Wave Ripple Rate

    doi: 10.3389/fneur.2017.00687

    Figure Lengend Snippet: Sharp-wave ripple (SWR) rates after various treatments. Lines connect data points from individual animals. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam; CtrlXXX, injection of equivalent volume of saline; 0.5, half an hour after injection, 4.5, four and half hours after injection.

    Article Snippet: AED Treatment Each animal received sequential intraperitoneal injections of levetiracetam (Keppra® , UCB, S.A., Brussels, Belgium), saline (control solution) of equal volume, lacosamide (Vimpat® , UCB, S.A., Brussels, Belgium), and saline of equal volume.

    Techniques: Laser Capture Microdissection, Injection

    Ratios of sharp-wave ripple (SWR) rates after drug treatment to rates after saline treatment for individual rats. Dashed line is at value 1 which constitutes no effect. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam; CtrlXXX, injection of an equivalent volume of saline; 0.5, half an hour after injection; 4.5, four and half hours after injection.

    Journal: Frontiers in Neurology

    Article Title: Lacosamide and Levetiracetam Have No Effect on Sharp-Wave Ripple Rate

    doi: 10.3389/fneur.2017.00687

    Figure Lengend Snippet: Ratios of sharp-wave ripple (SWR) rates after drug treatment to rates after saline treatment for individual rats. Dashed line is at value 1 which constitutes no effect. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam; CtrlXXX, injection of an equivalent volume of saline; 0.5, half an hour after injection; 4.5, four and half hours after injection.

    Article Snippet: AED Treatment Each animal received sequential intraperitoneal injections of levetiracetam (Keppra® , UCB, S.A., Brussels, Belgium), saline (control solution) of equal volume, lacosamide (Vimpat® , UCB, S.A., Brussels, Belgium), and saline of equal volume.

    Techniques: Laser Capture Microdissection, Injection

    Medians of ratios of sharp-wave ripple (SWR) rates after drug injection to rates after corresponding saline injection. Error bars represent non-parametric confidence intervals of the medians. Dashed line is at value 1 which constitutes no effect. Dotted lines at values 0.75 and 1.25 represent equality margins. LEV confidence intervals are at 96% confidence and do not cross the equality margins. LCM significantly increases SWR rate 0.5 h after administration, but 4.5 h after administration the effect dissipates. Confidence intervals are 93%. DIA markedly reduces SWR rate 0.5 h after administration and 4.5 h after administration the effect slowly dissipates. Confidence intervals are 75%. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam.

    Journal: Frontiers in Neurology

    Article Title: Lacosamide and Levetiracetam Have No Effect on Sharp-Wave Ripple Rate

    doi: 10.3389/fneur.2017.00687

    Figure Lengend Snippet: Medians of ratios of sharp-wave ripple (SWR) rates after drug injection to rates after corresponding saline injection. Error bars represent non-parametric confidence intervals of the medians. Dashed line is at value 1 which constitutes no effect. Dotted lines at values 0.75 and 1.25 represent equality margins. LEV confidence intervals are at 96% confidence and do not cross the equality margins. LCM significantly increases SWR rate 0.5 h after administration, but 4.5 h after administration the effect dissipates. Confidence intervals are 93%. DIA markedly reduces SWR rate 0.5 h after administration and 4.5 h after administration the effect slowly dissipates. Confidence intervals are 75%. LEV, levetiracetam; LCM, lacosamide; DIA, diazepam.

    Article Snippet: AED Treatment Each animal received sequential intraperitoneal injections of levetiracetam (Keppra® , UCB, S.A., Brussels, Belgium), saline (control solution) of equal volume, lacosamide (Vimpat® , UCB, S.A., Brussels, Belgium), and saline of equal volume.

    Techniques: Injection, Laser Capture Microdissection