primer concentrations Search Results


  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 99
    Thermo Fisher oligo concentrations
    Oligo Concentrations, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 10 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/oligo concentrations/product/Thermo Fisher
    Average 99 stars, based on 10 article reviews
    Price from $9.99 to $1999.99
    oligo concentrations - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    99
    Millipore primer concentrations
    Primer Concentrations, supplied by Millipore, used in various techniques. Bioz Stars score: 99/100, based on 17 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer concentrations/product/Millipore
    Average 99 stars, based on 17 article reviews
    Price from $9.99 to $1999.99
    primer concentrations - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    88
    Thermo Fisher primer concentration
    Primer Concentration, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 88/100, based on 46 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer concentration/product/Thermo Fisher
    Average 88 stars, based on 46 article reviews
    Price from $9.99 to $1999.99
    primer concentration - by Bioz Stars, 2020-09
    88/100 stars
      Buy from Supplier

    99
    Thermo Fisher standard concentration custom primer each
    Standard Concentration Custom Primer Each, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/standard concentration custom primer each/product/Thermo Fisher
    Average 99 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    standard concentration custom primer each - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    99
    Thermo Fisher pfu polymerase
    Pfu Polymerase, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 2647 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/pfu polymerase/product/Thermo Fisher
    Average 99 stars, based on 2647 article reviews
    Price from $9.99 to $1999.99
    pfu polymerase - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    99
    Thermo Fisher concentrated random primers
    Concentrated Random Primers, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 8 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/concentrated random primers/product/Thermo Fisher
    Average 99 stars, based on 8 article reviews
    Price from $9.99 to $1999.99
    concentrated random primers - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    93
    Thermo Fisher concentration odf1 primers
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Concentration Odf1 Primers, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 93/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/concentration odf1 primers/product/Thermo Fisher
    Average 93 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    concentration odf1 primers - by Bioz Stars, 2020-09
    93/100 stars
      Buy from Supplier

    99
    Thermo Fisher gene primer final concentration probe final concentration pcr master mix actb f
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Gene Primer Final Concentration Probe Final Concentration Pcr Master Mix Actb F, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/gene primer final concentration probe final concentration pcr master mix actb f/product/Thermo Fisher
    Average 99 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    gene primer final concentration probe final concentration pcr master mix actb f - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    99
    Thermo Fisher human gapdh
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Human Gapdh, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 1069 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/human gapdh/product/Thermo Fisher
    Average 99 stars, based on 1069 article reviews
    Price from $9.99 to $1999.99
    human gapdh - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    99
    Thermo Fisher cdna concentration
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Cdna Concentration, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 66 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/cdna concentration/product/Thermo Fisher
    Average 99 stars, based on 66 article reviews
    Price from $9.99 to $1999.99
    cdna concentration - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    91
    Carlsberg primer concentration
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Primer Concentration, supplied by Carlsberg, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer concentration/product/Carlsberg
    Average 91 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    primer concentration - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    93
    Eurofins primer concentration
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Primer Concentration, supplied by Eurofins, used in various techniques. Bioz Stars score: 93/100, based on 7 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer concentration/product/Eurofins
    Average 93 stars, based on 7 article reviews
    Price from $9.99 to $1999.99
    primer concentration - by Bioz Stars, 2020-09
    93/100 stars
      Buy from Supplier

    91
    Stratagene primer concentrations
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Primer Concentrations, supplied by Stratagene, used in various techniques. Bioz Stars score: 91/100, based on 44 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer concentrations/product/Stratagene
    Average 91 stars, based on 44 article reviews
    Price from $9.99 to $1999.99
    primer concentrations - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    97
    Thermo Fisher primer probe concentrations
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Primer Probe Concentrations, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 97/100, based on 20 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer probe concentrations/product/Thermo Fisher
    Average 97 stars, based on 20 article reviews
    Price from $9.99 to $1999.99
    primer probe concentrations - by Bioz Stars, 2020-09
    97/100 stars
      Buy from Supplier

    99
    Thermo Fisher primer sets
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Primer Sets, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 99/100, based on 121 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/primer sets/product/Thermo Fisher
    Average 99 stars, based on 121 article reviews
    Price from $9.99 to $1999.99
    primer sets - by Bioz Stars, 2020-09
    99/100 stars
      Buy from Supplier

    94
    Thermo Fisher wash solution ii
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Wash Solution Ii, supplied by Thermo Fisher, used in various techniques. Bioz Stars score: 94/100, based on 6 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/wash solution ii/product/Thermo Fisher
    Average 94 stars, based on 6 article reviews
    Price from $9.99 to $1999.99
    wash solution ii - by Bioz Stars, 2020-09
    94/100 stars
      Buy from Supplier

    90
    Microsynth yy microsynth for primer concentrations see
    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) <t>anti-ODF1.Confocal</t> fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.
    Yy Microsynth For Primer Concentrations See, supplied by Microsynth, used in various techniques. Bioz Stars score: 90/100, based on 3 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/yy microsynth for primer concentrations see/product/Microsynth
    Average 90 stars, based on 3 article reviews
    Price from $9.99 to $1999.99
    yy microsynth for primer concentrations see - by Bioz Stars, 2020-09
    90/100 stars
      Buy from Supplier

    Image Search Results


    Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) anti-ODF1.Confocal fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.

    Journal: Heliyon

    Article Title: ODF1, sperm flagelar protein is expressed in kidney collecting ducts of rats

    doi: 10.1016/j.heliyon.2019.e02932

    Figure Lengend Snippet: Confocal fluorescence micrographs of testis sections, incubated without (a, b, c and d) and with (e, f, g and h)) anti-ODF1.Confocal fluorescence micrographs of liver sections, incubated without (i, j, k and l) and with (m, n, o and p)) anti-ODF1. Blue fluorescence: Nuclei localization with Hoechst (a, e, i and m). Green fluorescence: anti-ODF1 labeled with FITC (b, f, j and n). Phase contrast (c, g, k and o). Overlay of blue and green fluorescence signal (d, h, l and p). Images shown are representative of three separate experiments. 40X Scale bar: 20 μm.

    Article Snippet: A primer designed using Primer3® software ( www.ncbi.nlm.nih.gov/tools/primer-blast/ ) was used for the amplification by PCR at equimolar concentration.Odf1 primers (Invitrogen).

    Techniques: Fluorescence, Incubation, Labeling

    Confocal fluorescence micrographs of kidney sections, incubated without (a, b, c, d and e) and with (f, g, h, i, j, k, l, m, n and o) anti-ODF1and anti AQP2. Blue fluorescence: Nuclei localization (a, f and k). Green fluorescence: anti-ODF1 (b, g and l). Red fluorescence: anti AQP2 (c, h and m). Phase contrast (d, i and n). Overlay of blue, green and red fluorescence signal (e, j and o). Cortex (f, g, h, i and j) and medulla (k, l, m, n and o) cross-section are exposed. Images shown are representative of three separate experiments.60X Scale bar: 20 μm.

    Journal: Heliyon

    Article Title: ODF1, sperm flagelar protein is expressed in kidney collecting ducts of rats

    doi: 10.1016/j.heliyon.2019.e02932

    Figure Lengend Snippet: Confocal fluorescence micrographs of kidney sections, incubated without (a, b, c, d and e) and with (f, g, h, i, j, k, l, m, n and o) anti-ODF1and anti AQP2. Blue fluorescence: Nuclei localization (a, f and k). Green fluorescence: anti-ODF1 (b, g and l). Red fluorescence: anti AQP2 (c, h and m). Phase contrast (d, i and n). Overlay of blue, green and red fluorescence signal (e, j and o). Cortex (f, g, h, i and j) and medulla (k, l, m, n and o) cross-section are exposed. Images shown are representative of three separate experiments.60X Scale bar: 20 μm.

    Article Snippet: A primer designed using Primer3® software ( www.ncbi.nlm.nih.gov/tools/primer-blast/ ) was used for the amplification by PCR at equimolar concentration.Odf1 primers (Invitrogen).

    Techniques: Fluorescence, Incubation

    ODF1 MS/MS spectrum . I n (a) the spectrum of the peptide sequence: ILASSCCSSNILGSVNVCGFEPDQVKVRVK, C6-Carbamidomethyl (57.021146 Da), C7-Carbamidomethyl (57.02146 Da), C18-Carbamidomethyl (57.02146 Da). In (b) the spectrum of the peptide sequence EFSLPPCVDEKDVTYSYGLGSCVK, C22-Carbamidomethyl (57.021146 Da).

    Journal: Heliyon

    Article Title: ODF1, sperm flagelar protein is expressed in kidney collecting ducts of rats

    doi: 10.1016/j.heliyon.2019.e02932

    Figure Lengend Snippet: ODF1 MS/MS spectrum . I n (a) the spectrum of the peptide sequence: ILASSCCSSNILGSVNVCGFEPDQVKVRVK, C6-Carbamidomethyl (57.021146 Da), C7-Carbamidomethyl (57.02146 Da), C18-Carbamidomethyl (57.02146 Da). In (b) the spectrum of the peptide sequence EFSLPPCVDEKDVTYSYGLGSCVK, C22-Carbamidomethyl (57.021146 Da).

    Article Snippet: A primer designed using Primer3® software ( www.ncbi.nlm.nih.gov/tools/primer-blast/ ) was used for the amplification by PCR at equimolar concentration.Odf1 primers (Invitrogen).

    Techniques: Mass Spectrometry, Sequencing

    ODF1 immunodetection by western blot, in proteins obtained from t estis (T), k idney total fraction (K), l iver (L), k idney c ortex- c ytoskeleton (KC–C) k idney m edulla- c ytoskeleton (KM-C), k idney c ortex- n on c ytoskeleton (KC-NC) k idney m edulla- non c ytoskeleton (KM-NC). Different antibodies were used: in panel a: an antibody raised against a peptide mapped near the N-terminus and in panel ban antibody raised against a peptide mapping within an internal region, of ODF1 of human origin. In panel c an antibody against α-tubulin was used. On the left the approximate molecular weight was indicated. The results are representative from three separated experiments. In panel d: Odf1-mRNA expression detected by RT-PCR. In panel e: β actin-mRNA expression detected by RT-PCR. From left to right: PBM (pair base marker), T, K and L. The results are representative from two separated experiments. In panel f: optical density ratio of ODF1 relative to β-ACTIN and normalized to testis expression.

    Journal: Heliyon

    Article Title: ODF1, sperm flagelar protein is expressed in kidney collecting ducts of rats

    doi: 10.1016/j.heliyon.2019.e02932

    Figure Lengend Snippet: ODF1 immunodetection by western blot, in proteins obtained from t estis (T), k idney total fraction (K), l iver (L), k idney c ortex- c ytoskeleton (KC–C) k idney m edulla- c ytoskeleton (KM-C), k idney c ortex- n on c ytoskeleton (KC-NC) k idney m edulla- non c ytoskeleton (KM-NC). Different antibodies were used: in panel a: an antibody raised against a peptide mapped near the N-terminus and in panel ban antibody raised against a peptide mapping within an internal region, of ODF1 of human origin. In panel c an antibody against α-tubulin was used. On the left the approximate molecular weight was indicated. The results are representative from three separated experiments. In panel d: Odf1-mRNA expression detected by RT-PCR. In panel e: β actin-mRNA expression detected by RT-PCR. From left to right: PBM (pair base marker), T, K and L. The results are representative from two separated experiments. In panel f: optical density ratio of ODF1 relative to β-ACTIN and normalized to testis expression.

    Article Snippet: A primer designed using Primer3® software ( www.ncbi.nlm.nih.gov/tools/primer-blast/ ) was used for the amplification by PCR at equimolar concentration.Odf1 primers (Invitrogen).

    Techniques: Immunodetection, Western Blot, Molecular Weight, Expressing, Reverse Transcription Polymerase Chain Reaction, Marker

    Coomassie blue staining of protein profile observed in the supernatant (a) and the pellet (c), obtained of homogenates from testis (T), kidney (K), liver (L), brain (B) and lung (Lu). ODF1 immunodetection by western blot in the supernatant (b) and in the pellet (d) observed in homogenates from testis (T), kidney (K), liver (L), brain (B) and lung (Lu).On the right the approximate molecular weight was indicated. The results are representative from three separated experiments.

    Journal: Heliyon

    Article Title: ODF1, sperm flagelar protein is expressed in kidney collecting ducts of rats

    doi: 10.1016/j.heliyon.2019.e02932

    Figure Lengend Snippet: Coomassie blue staining of protein profile observed in the supernatant (a) and the pellet (c), obtained of homogenates from testis (T), kidney (K), liver (L), brain (B) and lung (Lu). ODF1 immunodetection by western blot in the supernatant (b) and in the pellet (d) observed in homogenates from testis (T), kidney (K), liver (L), brain (B) and lung (Lu).On the right the approximate molecular weight was indicated. The results are representative from three separated experiments.

    Article Snippet: A primer designed using Primer3® software ( www.ncbi.nlm.nih.gov/tools/primer-blast/ ) was used for the amplification by PCR at equimolar concentration.Odf1 primers (Invitrogen).

    Techniques: Staining, Immunodetection, Western Blot, Molecular Weight