Structured Review

Becton Dickinson t25 flasks
Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in <t>T25</t> flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm
T25 Flasks, supplied by Becton Dickinson, used in various techniques. Bioz Stars score: 94/100, based on 28 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/t25 flasks/product/Becton Dickinson
Average 94 stars, based on 28 article reviews
Price from $9.99 to $1999.99
t25 flasks - by Bioz Stars, 2020-04
94/100 stars

Images

1) Product Images from "Full-length amelogenin influences the differentiation of human dental pulp stem cells"

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells

Journal: Stem Cell Research & Therapy

doi: 10.1186/s13287-015-0269-9

Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in T25 flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm
Figure Legend Snippet: Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in T25 flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm

Techniques Used: Light Microscopy, Cell Culture, Modification

Related Articles

Cell Isolation:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen). .. To isolate memory CD4+ T cells from PBMCs, dead cells were firstly removed with Dead Cell Removal Kit (Miltenyi Biotec), and viable cells were sorted by the negative selection with Memory CD4+ T cell Isolation Kit (Miltenyi Biotec).

Article Title: Isolation and Characterization of Chorionic Mesenchymal Stromal Cells from Human Full Term Placenta
Article Snippet: Paragraph title: Cell isolation from the placental tissue and cell culture ... The cells were resuspended in α-modified minimum essential medium (α-MEM; Gibco) supplemented with 10% fetal bovine serum (FBS; Hyclone, South Logan, Utah, USA) and 1% penicillin-streptomycin (Gibco), and cultured in T25 flasks (BD Falcon) at 37℃ and 5% CO2 .

Stable Transfection:

Article Title: Selective NaV1.1 activation rescues Dravet syndrome mice from seizures and premature death
Article Snippet: Paragraph title: Tissue Cell Culture and Stable Transfection. ... Cells were grown to ∼70% confluency in T25 flasks (BD Biosciences).

Modification:

Article Title: Enterohemorrhagic Escherichia coli O157:H7 Gene Expression Profiling in Response to Growth in the Presence of Host Epithelia
Article Snippet: Trypsinized cells were then pelleted, centrifuged at 500 rpm for 5 min (Beckman Coulter, Mississauga, Ontario), resuspended in minimal essential tissue culture medium, and re-seeded into either T25 flasks or 6-cm Petri dishes (Becton Dickinson Labware, Franklin Lakes, NJ) and again grown at 37°C in 5% CO2 until confluent. .. As previously described , T84 cells were grown in a 1∶1 mixture of Dulbecco's modified Eagle's medium and Ham's F-12 medium.

Incubation:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: .. To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen). .. The cells were stimulated with 20 ng/ml hIL-23 (R & D Systems) or PBS for 20 minutes and collected for Phosflow analysis.

Article Title: Enterohemorrhagic Escherichia coli O157:H7 Gene Expression Profiling in Response to Growth in the Presence of Host Epithelia
Article Snippet: Trypsinized cells were then pelleted, centrifuged at 500 rpm for 5 min (Beckman Coulter, Mississauga, Ontario), resuspended in minimal essential tissue culture medium, and re-seeded into either T25 flasks or 6-cm Petri dishes (Becton Dickinson Labware, Franklin Lakes, NJ) and again grown at 37°C in 5% CO2 until confluent. .. Prior to bacterial infection, cells were incubated (24 hr at 37°C in 5% CO2 ) in minimal essential tissue culture medium without antibiotics and fetal bovine serum, as previously described .

Article Title: Collagenase Impacts the Quantity and Quality of Native Mesenchymal Stem/Stromal Cells Derived during Processing of Umbilical Cord Tissue
Article Snippet: Ex vivo MSC Expansion Cultures from Native Cells Native cells recovered from UCT processed with the AC:Px System or in the presence of collagenase were seeded into 12-well plates, 60-mm dishes, or T25 flasks (BD Falcon) in CTS™ StemPro MSC SFM (Invitrogen), per the manufacturer’s instructions. .. CTS CELLstart™ attachment substrate (Invitrogen) was coated onto culture surfaces per the manufacturer’s instructions and incubated at 37°C for 2 h. In postincubation, the substrate was carefully aspirated without disturbing the coated monolayer.

Article Title: Metformin Enhanced in Vitro Radiosensitivity Associates with G2/M Cell Cycle Arrest and Elevated Adenosine-5’-monophosphate-activated Protein Kinase Levels in Glioblastoma
Article Snippet: Low passage cells were plated in T25 flasks (Becton, Dickinson, Heidelberg, Germany) with 5 ml medium as described previously. .. Cell samples were incubated with 10 μM or 50 μM TMZ for 4 hours prior to irradiation.

Cell Culture:

Article Title: Selective NaV1.1 activation rescues Dravet syndrome mice from seizures and premature death
Article Snippet: Paragraph title: Tissue Cell Culture and Stable Transfection. ... Cells were grown to ∼70% confluency in T25 flasks (BD Biosciences).

Article Title: A feeder-cell independent subpopulation of the PICM-19 pig liver stem cell line capable of long-term growth and extensive expansion
Article Snippet: Paragraph title: Cell culture ... PICM-19FF cells were propagated on polymerized collagen-coated T12.5 or T25 flasks (Falcon cultureware; BD Biosciences, Franklin Lakes, NJ and Greiner, Frickenhausen, Germany, respectively) as previously described (Talbot et al. ).

Article Title: IL-10 Production Is Critical for Sustaining the Expansion of CD5+ B and NKT Cells and Restraining Autoantibody Production in Congenic Lupus-Prone Mice
Article Snippet: Paragraph title: CFSE Staining and Peritoneal B cell Culture ... Immediately after lavage, cells were transferred to T25 flasks (BD Biosciences, San Diego, CA, USA) and rested for 2 hours in a 37°C, 5% CO2 tissue culture incubator.

Article Title: Isolation and Characterization of Chorionic Mesenchymal Stromal Cells from Human Full Term Placenta
Article Snippet: .. The cells were resuspended in α-modified minimum essential medium (α-MEM; Gibco) supplemented with 10% fetal bovine serum (FBS; Hyclone, South Logan, Utah, USA) and 1% penicillin-streptomycin (Gibco), and cultured in T25 flasks (BD Falcon) at 37℃ and 5% CO2 . ..

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week. .. Cell morphology, proliferation and viability The specimens were examined daily under inverted light microscopy (AXIO, Zeiss, Jena, Germany).

Article Title: Assessing Candidate Gene nsSNPs for Phenotypic Differences in Double-Strand Break Repair Using Radiation-Induced γH2A.X Foci
Article Snippet: Paragraph title: 2.3. Cell culture and irradiation conditions ... The day before irradiation, cells were seeded at 3.5 × 105 cells/mL in T25 flasks (BD Falcon, Franklin Lakes, NJ, USA).

Mass Spectrometry:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: Cells were retrievals of cryopreserved samples from both healthy controls and MS patients of similar age, sex, and length of cryopresevation. .. To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen).

Ex Vivo:

Article Title: Collagenase Impacts the Quantity and Quality of Native Mesenchymal Stem/Stromal Cells Derived during Processing of Umbilical Cord Tissue
Article Snippet: .. Ex vivo MSC Expansion Cultures from Native Cells Native cells recovered from UCT processed with the AC:Px System or in the presence of collagenase were seeded into 12-well plates, 60-mm dishes, or T25 flasks (BD Falcon) in CTS™ StemPro MSC SFM (Invitrogen), per the manufacturer’s instructions. .. The working medium contained CTS StemPro MSC SFM basal medium, 25-μg/mL gentamicin, 100-IU/mL penicillin, 100-μg/mL streptomycin, 0.25-μg/mL amphotericin B (Invitrogen), 10-μg/mL ciprofloxacin (Mediatech), CTS StemPro™ MSC SFM supplement, and 1% GlutaMAX (Invitrogen).

Derivative Assay:

Article Title: Isolation and Characterization of Chorionic Mesenchymal Stromal Cells from Human Full Term Placenta
Article Snippet: Because chorionic MSCs were derived from the reticular layer of the chorion, the decidual tissue was scrapped mechanically and washed in Dulbecco's phosphate-buffered saline (DPBS; Gibco, Grand Island, NY, USA) before being cut into small pieces (-2 × 2 cm). .. The cells were resuspended in α-modified minimum essential medium (α-MEM; Gibco) supplemented with 10% fetal bovine serum (FBS; Hyclone, South Logan, Utah, USA) and 1% penicillin-streptomycin (Gibco), and cultured in T25 flasks (BD Falcon) at 37℃ and 5% CO2 .

Transfection:

Article Title: Selective NaV1.1 activation rescues Dravet syndrome mice from seizures and premature death
Article Snippet: CHO cells stably transfected with hSCN4A and hSCN8A were maintained in Ham’s F-12 Nutrient Mixture (Invitrogen) supplemented with 10% (vol/vol) FBS, 0.9% P/S solution, and 100 μg/mL hygromycin. .. Cells were grown to ∼70% confluency in T25 flasks (BD Biosciences).

Concentration Assay:

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: The same supplemented medium was used in the amelogenin groups, adding the amelogenin protein at a concentration of 10 ng/mL, 100 ng/mL and 1000 ng/mL. .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

Serial Dilution:

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: The hDPSCs were assigned to four different groups: a control, and three groups with a serial dilution of amelogenin. .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

Infection:

Article Title: Enterohemorrhagic Escherichia coli O157:H7 Gene Expression Profiling in Response to Growth in the Presence of Host Epithelia
Article Snippet: Trypsinized cells were then pelleted, centrifuged at 500 rpm for 5 min (Beckman Coulter, Mississauga, Ontario), resuspended in minimal essential tissue culture medium, and re-seeded into either T25 flasks or 6-cm Petri dishes (Becton Dickinson Labware, Franklin Lakes, NJ) and again grown at 37°C in 5% CO2 until confluent. .. Prior to bacterial infection, cells were incubated (24 hr at 37°C in 5% CO2 ) in minimal essential tissue culture medium without antibiotics and fetal bovine serum, as previously described .

Sequencing:

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: The amelogenin was provided by Abnova Biotec GmbH (Taipei, Taiwan): it is a human recombinant protein, full-length product of the gene Amelx (1-191a.a.), weighting approximately 48 kDa, which primary sequence [NX_Q99217-1] is MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD. .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

Injection:

Article Title: IL-10 Production Is Critical for Sustaining the Expansion of CD5+ B and NKT Cells and Restraining Autoantibody Production in Congenic Lupus-Prone Mice
Article Snippet: CFSE Staining and Peritoneal B cell Culture Peritoneal lavages were taken from mice previously injected with 5mL complete RPMI 1640 (Gibco, Waltham, MA, USA) media supplemented with 10% FBS (Wisent, ST-BRUNO, Quebec, Canada), L-glutamine (Gibco, Waltham, MA, USA), non-essential amino acids (Gibco, Waltham, MA, USA), and penicillin and streptomycin (Gibco, Waltham, MA, USA). .. Immediately after lavage, cells were transferred to T25 flasks (BD Biosciences, San Diego, CA, USA) and rested for 2 hours in a 37°C, 5% CO2 tissue culture incubator.

Recombinant:

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: The amelogenin was provided by Abnova Biotec GmbH (Taipei, Taiwan): it is a human recombinant protein, full-length product of the gene Amelx (1-191a.a.), weighting approximately 48 kDa, which primary sequence [NX_Q99217-1] is MGTWILFACLLGAAFAMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD. .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

Isolation:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: Paragraph title: Memory CD4+ T cells activation and isolation. ... To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen).

Mouse Assay:

Article Title: IL-10 Production Is Critical for Sustaining the Expansion of CD5+ B and NKT Cells and Restraining Autoantibody Production in Congenic Lupus-Prone Mice
Article Snippet: CFSE Staining and Peritoneal B cell Culture Peritoneal lavages were taken from mice previously injected with 5mL complete RPMI 1640 (Gibco, Waltham, MA, USA) media supplemented with 10% FBS (Wisent, ST-BRUNO, Quebec, Canada), L-glutamine (Gibco, Waltham, MA, USA), non-essential amino acids (Gibco, Waltham, MA, USA), and penicillin and streptomycin (Gibco, Waltham, MA, USA). .. Immediately after lavage, cells were transferred to T25 flasks (BD Biosciences, San Diego, CA, USA) and rested for 2 hours in a 37°C, 5% CO2 tissue culture incubator.

Polymerase Chain Reaction:

Article Title: Enterohemorrhagic Escherichia coli O157:H7 Gene Expression Profiling in Response to Growth in the Presence of Host Epithelia
Article Snippet: Trypsinized cells were then pelleted, centrifuged at 500 rpm for 5 min (Beckman Coulter, Mississauga, Ontario), resuspended in minimal essential tissue culture medium, and re-seeded into either T25 flasks or 6-cm Petri dishes (Becton Dickinson Labware, Franklin Lakes, NJ) and again grown at 37°C in 5% CO2 until confluent. .. A polarized intestinal epithelial cell line, T84, was employed as a complementary cell line for PCR experiments.

Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells
Article Snippet: All the experiments were carried out in biological triplicates, while PCR analyses were carried out in technical triplicates. .. The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

Irradiation:

Article Title: Metformin Enhanced in Vitro Radiosensitivity Associates with G2/M Cell Cycle Arrest and Elevated Adenosine-5’-monophosphate-activated Protein Kinase Levels in Glioblastoma
Article Snippet: Paragraph title: Drug treatment and irradiation ... Low passage cells were plated in T25 flasks (Becton, Dickinson, Heidelberg, Germany) with 5 ml medium as described previously.

Article Title: Identification of stable endogenous control genes for transcriptional profiling of photon, proton and carbon-ion irradiated cells
Article Snippet: .. Irradiation Cells were irradiated in T25 flasks with 2Gy of photon, 2Gy of proton and 1Gy of carbon ion. .. Photon was delivered by a linear accelerator at 6 Mev (Mevatron, Siemens, Erlangen, Germany).

Article Title: Assessing Candidate Gene nsSNPs for Phenotypic Differences in Double-Strand Break Repair Using Radiation-Induced γH2A.X Foci
Article Snippet: .. The day before irradiation, cells were seeded at 3.5 × 105 cells/mL in T25 flasks (BD Falcon, Franklin Lakes, NJ, USA). .. Cells were exposed to 1.5 Gy on ice in 1 mL complete media while under constant rotation using a J. L. Sheperd Model 431 137 Cs irradiator at a dose rate of 0.77 Gy/min.

Selection:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen). .. To isolate memory CD4+ T cells from PBMCs, dead cells were firstly removed with Dead Cell Removal Kit (Miltenyi Biotec), and viable cells were sorted by the negative selection with Memory CD4+ T cell Isolation Kit (Miltenyi Biotec).

Activation Assay:

Article Title: IL-23R–activated STAT3/STAT4 is essential for Th1/Th17-mediated CNS autoimmunity
Article Snippet: Paragraph title: Memory CD4+ T cells activation and isolation. ... To activate memory CD4+ T cells, PBMCs were incubated in T25 flasks for at least 2 hours to deplete adherent cells and then plated at 4 × 106 cells/well in 24-well plates precoated with anti–human CD3 (HIT3a, BD Pharmingen).

Mineralization Assay:

Article Title: Alteration of proteoglycan sulfation affects bone growth and remodeling
Article Snippet: .. For osteoblast mineralization assay, primary osteoblasts were seeded into T25 flasks (BD Falcon) at a density of 3 × 105 cells/flask in α-MEM containing 10% HI-FCS and 1% antibiotics and maintained at 37 °C in 5% CO2 until they reached confluence (typically after 4 to 6 days), changing medium every second day. .. Adherent cells were trypsinized and re-plated in 6-well plates (BD Falcon) at a density of 2 × 105 cells/well in the same medium, supplemented with 100 μg/ml ascorbic acid and 5 mM β-glycerophosphate to induce matrix mineralization, and maintained at 37 °C in 5% CO2 .

Staining:

Article Title: IL-10 Production Is Critical for Sustaining the Expansion of CD5+ B and NKT Cells and Restraining Autoantibody Production in Congenic Lupus-Prone Mice
Article Snippet: Paragraph title: CFSE Staining and Peritoneal B cell Culture ... Immediately after lavage, cells were transferred to T25 flasks (BD Biosciences, San Diego, CA, USA) and rested for 2 hours in a 37°C, 5% CO2 tissue culture incubator.

Article Title: Alteration of proteoglycan sulfation affects bone growth and remodeling
Article Snippet: For osteoblast mineralization assay, primary osteoblasts were seeded into T25 flasks (BD Falcon) at a density of 3 × 105 cells/flask in α-MEM containing 10% HI-FCS and 1% antibiotics and maintained at 37 °C in 5% CO2 until they reached confluence (typically after 4 to 6 days), changing medium every second day. .. The medium was changed every second day and mineralized nodule formation was observed after different culture times (1, 2, 4 and 6 weeks) by Von Kossa staining, according to standard procedures .

Similar Products

  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 94
    Becton Dickinson t25 flasks
    Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in <t>T25</t> flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm
    T25 Flasks, supplied by Becton Dickinson, used in various techniques. Bioz Stars score: 94/100, based on 30 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/t25 flasks/product/Becton Dickinson
    Average 94 stars, based on 30 article reviews
    Price from $9.99 to $1999.99
    t25 flasks - by Bioz Stars, 2020-04
    94/100 stars
      Buy from Supplier

    95
    Becton Dickinson t25 flask
    Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in <t>T25</t> flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm
    T25 Flask, supplied by Becton Dickinson, used in various techniques. Bioz Stars score: 95/100, based on 12 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/t25 flask/product/Becton Dickinson
    Average 95 stars, based on 12 article reviews
    Price from $9.99 to $1999.99
    t25 flask - by Bioz Stars, 2020-04
    95/100 stars
      Buy from Supplier

    Image Search Results


    Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in T25 flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm

    Journal: Stem Cell Research & Therapy

    Article Title: Full-length amelogenin influences the differentiation of human dental pulp stem cells

    doi: 10.1186/s13287-015-0269-9

    Figure Lengend Snippet: Representative light microscopy images of human dental pulp stem cells (hDPSCs). The cells were seeded in T25 flasks at a density of 2*10 4 cells/cm 2 and cultured in minimal essential medium, α-modification supplemented with 10 % fetal bovine serum and 1 % Penicillin/Streptomicin and monitored at day 21 (×10) ( a ); hDPSCs after 21 days of cultivation with a supplement of 10 ng/mL ( b ), 100 ng/mL ( c ) and 1000 ng/mL amelogenin ( d ). Scale bars 100 μm

    Article Snippet: The cells were seeded in T25 flasks (BD Falcon, San Jose, CA, USA), at a density of 2*104 cells/cm2 and cultured in a humidified atmosphere containing 5 % CO2 at 37 °C, with the medium changed twice a week.

    Techniques: Light Microscopy, Cell Culture, Modification