|
MedChemExpress
napi2b in 2 Napi2b In 2, supplied by MedChemExpress, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/napi2b in 2/product/MedChemExpress Average 94 stars, based on 1 article reviews
napi2b in 2 - by Bioz Stars,
2026-05
94/100 stars
|
Buy from Supplier |
|
R&D Systems
napi2b ![]() Napi2b, supplied by R&D Systems, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/napi2b/product/R&D Systems Average 94 stars, based on 1 article reviews
napi2b - by Bioz Stars,
2026-05
94/100 stars
|
Buy from Supplier |
|
Galectin Therapeutics
trop2/galectin-3/napi2b ![]() Trop2/Galectin 3/Napi2b, supplied by Galectin Therapeutics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/trop2/galectin-3/napi2b/product/Galectin Therapeutics Average 90 stars, based on 1 article reviews
trop2/galectin-3/napi2b - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Galectin Therapeutics
trop2 galectin-3 napi2b ![]() Trop2 Galectin 3 Napi2b, supplied by Galectin Therapeutics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/trop2 galectin-3 napi2b/product/Galectin Therapeutics Average 90 stars, based on 1 article reviews
trop2 galectin-3 napi2b - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Mersana Inc
adc mmaf napi2b xmt− 1592 ![]() Adc Mmaf Napi2b Xmt− 1592, supplied by Mersana Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/adc mmaf napi2b xmt− 1592/product/Mersana Inc Average 90 stars, based on 1 article reviews
adc mmaf napi2b xmt− 1592 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Mersana Inc
adc mmaf napi2b xmt− 1536 ![]() Adc Mmaf Napi2b Xmt− 1536, supplied by Mersana Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/adc mmaf napi2b xmt− 1536/product/Mersana Inc Average 90 stars, based on 1 article reviews
adc mmaf napi2b xmt− 1536 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Cell Signaling Technology Inc
anti slc34a2 ![]() Anti Slc34a2, supplied by Cell Signaling Technology Inc, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/anti slc34a2/product/Cell Signaling Technology Inc Average 93 stars, based on 1 article reviews
anti slc34a2 - by Bioz Stars,
2026-05
93/100 stars
|
Buy from Supplier |
|
GenScript corporation
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin ![]() Biotinylated Napi2b Derived Peptide Qinvtvpstanctspslcwtdgiqnwtmkn Biotin, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin/product/GenScript corporation Average 90 stars, based on 1 article reviews
biotinylated napi2b-derived peptide qinvtvpstanctspslcwtdgiqnwtmkn-biotin - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
|
Genentech inc
lifastuzumab vedotin; dnib0600a; napi2b adc; rg7599 ![]() Lifastuzumab Vedotin; Dnib0600a; Napi2b Adc; Rg7599, supplied by Genentech inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/lifastuzumab vedotin; dnib0600a; napi2b adc; rg7599/product/Genentech inc Average 90 stars, based on 1 article reviews
lifastuzumab vedotin; dnib0600a; napi2b adc; rg7599 - by Bioz Stars,
2026-05
90/100 stars
|
Buy from Supplier |
Journal: Nature Communications
Article Title: Human iPSC-based Modeling of Pulmonary Fibrosis Reveals p300/CBP Inhibition Suppresses Alveolar Transitional Cell State
doi: 10.1038/s41467-026-68909-z
Figure Lengend Snippet: a Gene expression of ATCS markers in the micro-patterned culture. Each well was treated with either DMSO or p300/CBP inhibitors (10 μM) from days 11 to 14. Data are presented as mean ± SEM (n = 3 biologically independent experiments). One-way ANOVA followed by Tukey’s multiple comparisons test; ** p < 0.01, *** p < 0.001, **** p < 0.0001. b Dot plots displaying the gene expression of iATCs-specific markers in representative cell populations from the micro-patterned culture, corresponding to those shown in Fig. . c Immunostaining of CD54 (ICAM1), lineage markers for ATCS (KRT19), AT1 cells (HT1-56), AT2 cells (NaPi2b), and nuclei (Hoechst) in micro-patterned cultures. Representative images from three biologically independent experiments with similar results are shown. Scale bar: 100 μm. d, e Flow cytometry analysis assessing the CD54 + cell ratio in the micro-patterned culture. Each well was treated with either DMSO or p300/CBP inhibitors (10 μM) from days 11 to 14. Data are presented as mean ± SEM (n = 3 biologically independent experiments). One-way ANOVA followed by Tukey’s multiple comparisons test; ** p < 0.01. f Schematic outline for sorting CD54 + iATCs from day 14 of the micro-patterned culture. Created in BioRender. Tsutsui, Y. (2026) https://BioRender.com/v51i925 g Gene expression data of ATCS markers in the micro-patterned culture. Data are presented as mean ± SEM ( n = 3 biologically independent experiments). One-way ANOVA followed by Tukey’s multiple comparisons test; ** p < 0.01, *** p < 0.001, **** p < 0.0001. h Schematic outline of the co-culture experiment involving isolated CD54 + iATCs and NHLFs. Created in BioRender. Tsutsui, Y. (2026) https://BioRender.com/nbi6c0b i Gene expression analysis of ATCS markers in isolated CD54 + iATCs. Data are presented as mean ± SEM ( n = 3 biologically independent experiments). One-way ANOVA followed by Tukey’s multiple comparisons test; ** p < 0.01. ns; not significant ( p > 0.05). j Gene expression analysis of fibroblast activation markers in NHLFs cocultured with or without iATCs. Data are presented as mean ± SEM ( n = 3 biologically independent experiments). Unpaired two-tailed Student’s t test: ∗ p < 0.05.
Article Snippet: Primary antibodies used in this study included GFP (1:500, Aves Labs, GFP-1020), SFN (1:200, Abcam, ab77187), act-p300 (1:200, biorbyt, ORB6262), EpCAM (1:200, Santa Cruz Biotechnology, sc-66020), KRT19 (1:200, Merck, MABT913), KRT17 (1:100, Abcam, ab109725), COL1A1 (1:200, Abcam, ab138492), CD54 (1:200, BioLegend, 353102), CD54 (1:200, Atlas, HPA002126), HT1-56 (1:200, Terrace Biotech, TB29AHT1-56),
Techniques: Gene Expression, Immunostaining, Flow Cytometry, Co-Culture Assay, Isolation, Activation Assay, Two Tailed Test