Structured Review

Stratagene e coli strains bl21 de3 gold
Expression in whole cell lysates: (A) Growth in an automated plate reader of E. coli <t>BL21</t> (DE3) <t>Gold</t> expressing 48 different pBAD constructs (left panel) and 48 different pET constructs (Right panel). Arrows indicate time of induction. (B) Dot blot analysis
E Coli Strains Bl21 De3 Gold, supplied by Stratagene, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/e coli strains bl21 de3 gold/product/Stratagene
Average 86 stars, based on 1 article reviews
Price from $9.99 to $1999.99
e coli strains bl21 de3 gold - by Bioz Stars, 2021-06
86/100 stars

Images

1) Product Images from "The funnel approach to the pre-crystallization production of membrane proteins"

Article Title: The funnel approach to the pre-crystallization production of membrane proteins

Journal: Journal of molecular biology

doi: 10.1016/j.jmb.2007.12.059

Expression in whole cell lysates: (A) Growth in an automated plate reader of E. coli BL21 (DE3) Gold expressing 48 different pBAD constructs (left panel) and 48 different pET constructs (Right panel). Arrows indicate time of induction. (B) Dot blot analysis
Figure Legend Snippet: Expression in whole cell lysates: (A) Growth in an automated plate reader of E. coli BL21 (DE3) Gold expressing 48 different pBAD constructs (left panel) and 48 different pET constructs (Right panel). Arrows indicate time of induction. (B) Dot blot analysis

Techniques Used: Expressing, Construct, Positron Emission Tomography, Dot Blot

Related Articles

Expressing:

Article Title: Identification of the SAAT Gene Involved in Strawberry Flavor Biogenesis by Use of DNA Microarrays
Article Snippet: Volatile compounds were identified by screening the National Institute of Standards and Technology library for comparable mass spectra and by comparison with authentic reference compounds (Aldrich). .. The expression vector pRSET B (Invitrogen, Carlsbad, CA) was used for the expression of SAAT (for strawberry alcohol acyltransferase [AAT]) in E. coli (Stratagene; BL21 Gold DE3 strain). .. The BamHI and HindIII restriction sites of the original pRSET B were primarily used for cloning the gene encoding the green fluorescent protein (GFP); this construct as well as the empty pRSET B vector served as controls for the experiments.

Article Title: The Effects of the Recombinant CCR5 T4 Lysozyme Fusion Protein on HIV-1 Infection
Article Snippet: .. The PET-20b expression vector and BL21-Gold (DE3) pLysS E . coli strain were purchased from Stratagene (La Jolla, CA). .. Ni-nitrilotriacetic acid (NTA) histidine binding beads were purchased from Sigma-Aldrich (St. Louis, MO).

Plasmid Preparation:

Article Title: Identification of the SAAT Gene Involved in Strawberry Flavor Biogenesis by Use of DNA Microarrays
Article Snippet: Volatile compounds were identified by screening the National Institute of Standards and Technology library for comparable mass spectra and by comparison with authentic reference compounds (Aldrich). .. The expression vector pRSET B (Invitrogen, Carlsbad, CA) was used for the expression of SAAT (for strawberry alcohol acyltransferase [AAT]) in E. coli (Stratagene; BL21 Gold DE3 strain). .. The BamHI and HindIII restriction sites of the original pRSET B were primarily used for cloning the gene encoding the green fluorescent protein (GFP); this construct as well as the empty pRSET B vector served as controls for the experiments.

Article Title: Combinatorial Engineering of 1-Deoxy-D-Xylulose 5-Phosphate Pathway Using Cross-Lapping In Vitro Assembly (CLIVA) Method
Article Snippet: The electroporation competent cells were prepared: 1 L of XL10-Gold cells at OD600~= 0.4, washed for three time with equal volume of 10% cold glycerol, suspended in 10 ml of cold 10% glycerol and stored at -80 °C. .. For amorphadiene production, the E. coli Bl21-Gold DE3 strain (Stratagene) harboring different kinds of DXP pathway plasmid together with the pRepressor plasmid carrying the lac repressor gene was cultured in production medium: peptone 20 g/L, yeast extract 10 g/L, NaCl 10 g/L, glycerol 20 g/L, HEPES 50 mM and Tween 80 5 g/L. .. The pRepressor plasmid was constructed by removing the T7 promoter, RBS and T7 terminator of pET-11a (Stratagene) plasmid and replacing the antibiotic resistant (ampicillin) with kanamycin.

Article Title: A quorum-sensing inhibitor blocks Pseudomonas aeruginosa virulence and biofilm formation
Article Snippet: .. Plasmid pET23b (Novagen) was used to express lasR and rhlR in E. coli strain BL21-Gold (DE3) (Stratagene). .. Plasmid pEVS141 ( ) was used for rhlA – gfp or rsaL – gfp expression and maintained with 50 μg/mL of kanamycin.

Article Title: The Effects of the Recombinant CCR5 T4 Lysozyme Fusion Protein on HIV-1 Infection
Article Snippet: .. The PET-20b expression vector and BL21-Gold (DE3) pLysS E . coli strain were purchased from Stratagene (La Jolla, CA). .. Ni-nitrilotriacetic acid (NTA) histidine binding beads were purchased from Sigma-Aldrich (St. Louis, MO).

Article Title: The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi
Article Snippet: Cells were induced at OD 600 ≈ 0.7 for 3–4 h with 0.2 mM of IPTG at 22°C, and lysates were prepared by sonication in 10 ml of lysis buffer (PBS, 1% [vol/vol] Triton X-100, 200 μM GDP, 5 mM MgCl2 , and 5 mM β-mercaptoethanol) containing protease inhibitors. .. The lysates were clarified by centrifugation at 12,000 g for 10 min. For coexpression experiments, Arf1p (T31N) and Arf1p (Q71L) were coexpressed with the COOH-terminal 126 amino acids of Rud3p in the polycistronic vector pOPCG and also expressed in the E. coli BL21-GOLD (DE3) strain (Stratagene). .. Affinity chromatography with immobilized GTPases GST-Arf1p, GST-Arf3p, or GST-Arl1p were purified, and then loaded with either GDP or GTP-γ-S as described previously ( ).

Cell Culture:

Article Title: Combinatorial Engineering of 1-Deoxy-D-Xylulose 5-Phosphate Pathway Using Cross-Lapping In Vitro Assembly (CLIVA) Method
Article Snippet: The electroporation competent cells were prepared: 1 L of XL10-Gold cells at OD600~= 0.4, washed for three time with equal volume of 10% cold glycerol, suspended in 10 ml of cold 10% glycerol and stored at -80 °C. .. For amorphadiene production, the E. coli Bl21-Gold DE3 strain (Stratagene) harboring different kinds of DXP pathway plasmid together with the pRepressor plasmid carrying the lac repressor gene was cultured in production medium: peptone 20 g/L, yeast extract 10 g/L, NaCl 10 g/L, glycerol 20 g/L, HEPES 50 mM and Tween 80 5 g/L. .. The pRepressor plasmid was constructed by removing the T7 promoter, RBS and T7 terminator of pET-11a (Stratagene) plasmid and replacing the antibiotic resistant (ampicillin) with kanamycin.

Recombinant:

Article Title: Neuronal Cx3cr1 Deficiency Protects against Amyloid β-Induced Neurotoxicity
Article Snippet: .. Recombinant met-Aβ (1–42) and met-Aβ (1–40) Recombinant met-Aβ (1–42) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV IA) and met-Aβ (1–40) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) were expressed in the E . coli BL21 Gold DE3 strain (Stratagene, La Jolla, CA) and purified as described previously, with slight modifications [ ]. .. Briefly, the purification procedure involved sonication of E . coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin.

Article Title: Systematic development of small molecules to inhibit specific microscopic steps of Aβ42 aggregation in Alzheimer’s disease
Article Snippet: .. The recombinant Aβ(M1–42) peptide (MDAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGVV IA), here called Aβ42, was expressed in the Escherichia coli BL21 Gold (DE3) strain (Stratagene) and purified as described previously with slight modifications ( ). .. Briefly, the purification procedure involved sonication of E. coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin and lyophilization.

IA:

Article Title: Neuronal Cx3cr1 Deficiency Protects against Amyloid β-Induced Neurotoxicity
Article Snippet: .. Recombinant met-Aβ (1–42) and met-Aβ (1–40) Recombinant met-Aβ (1–42) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV IA) and met-Aβ (1–40) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) were expressed in the E . coli BL21 Gold DE3 strain (Stratagene, La Jolla, CA) and purified as described previously, with slight modifications [ ]. .. Briefly, the purification procedure involved sonication of E . coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin.

Article Title: Systematic development of small molecules to inhibit specific microscopic steps of Aβ42 aggregation in Alzheimer’s disease
Article Snippet: .. The recombinant Aβ(M1–42) peptide (MDAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGVV IA), here called Aβ42, was expressed in the Escherichia coli BL21 Gold (DE3) strain (Stratagene) and purified as described previously with slight modifications ( ). .. Briefly, the purification procedure involved sonication of E. coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin and lyophilization.

Purification:

Article Title: Neuronal Cx3cr1 Deficiency Protects against Amyloid β-Induced Neurotoxicity
Article Snippet: .. Recombinant met-Aβ (1–42) and met-Aβ (1–40) Recombinant met-Aβ (1–42) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV IA) and met-Aβ (1–40) (MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) were expressed in the E . coli BL21 Gold DE3 strain (Stratagene, La Jolla, CA) and purified as described previously, with slight modifications [ ]. .. Briefly, the purification procedure involved sonication of E . coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin.

Article Title: Systematic development of small molecules to inhibit specific microscopic steps of Aβ42 aggregation in Alzheimer’s disease
Article Snippet: .. The recombinant Aβ(M1–42) peptide (MDAEFRHDSGY EVHHQKLVFF AEDVGSNKGA IIGLMVGGVV IA), here called Aβ42, was expressed in the Escherichia coli BL21 Gold (DE3) strain (Stratagene) and purified as described previously with slight modifications ( ). .. Briefly, the purification procedure involved sonication of E. coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin and lyophilization.

Positron Emission Tomography:

Article Title: The Effects of the Recombinant CCR5 T4 Lysozyme Fusion Protein on HIV-1 Infection
Article Snippet: .. The PET-20b expression vector and BL21-Gold (DE3) pLysS E . coli strain were purchased from Stratagene (La Jolla, CA). .. Ni-nitrilotriacetic acid (NTA) histidine binding beads were purchased from Sigma-Aldrich (St. Louis, MO).

Centrifugation:

Article Title: The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi
Article Snippet: Cells were induced at OD 600 ≈ 0.7 for 3–4 h with 0.2 mM of IPTG at 22°C, and lysates were prepared by sonication in 10 ml of lysis buffer (PBS, 1% [vol/vol] Triton X-100, 200 μM GDP, 5 mM MgCl2 , and 5 mM β-mercaptoethanol) containing protease inhibitors. .. The lysates were clarified by centrifugation at 12,000 g for 10 min. For coexpression experiments, Arf1p (T31N) and Arf1p (Q71L) were coexpressed with the COOH-terminal 126 amino acids of Rud3p in the polycistronic vector pOPCG and also expressed in the E. coli BL21-GOLD (DE3) strain (Stratagene). .. Affinity chromatography with immobilized GTPases GST-Arf1p, GST-Arf3p, or GST-Arl1p were purified, and then loaded with either GDP or GTP-γ-S as described previously ( ).

Similar Products

  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 86
    Stratagene bl21 escherichia coli host strain
    SDS gel electrophoretic pattern of recombinant AtSULT202B7 at different stages during purification . Samples were subjected to SDS – PAGE, followed by Coomassie blue staining. Lane 1, molecular weight markers; lane 2, <t>BL21</t> <t>Escherichia</t> coli homogenate
    Bl21 Escherichia Coli Host Strain, supplied by Stratagene, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/bl21 escherichia coli host strain/product/Stratagene
    Average 86 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    bl21 escherichia coli host strain - by Bioz Stars, 2021-06
    86/100 stars
      Buy from Supplier

    86
    Stratagene e coli bl21
    HPTLC chromatogram of total lipid extracts from phage isolates. Lane 1: Escherichia coli <t>BL21</t> positive control, lane 2: wild-type phage T7; lane 3: mutant phage T7::PhoE. Arrow head indicates the lipid species that is particularly enriched in the T7::PhoE mutant.
    E Coli Bl21, supplied by Stratagene, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/e coli bl21/product/Stratagene
    Average 86 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    e coli bl21 - by Bioz Stars, 2021-06
    86/100 stars
      Buy from Supplier

    86
    Stratagene chemicals escherichia coli strains
    ( A ) SDS-PAGE analysis of PA27. Lane M, marker, lane 1 2; crude <t>Escherichia</t> coli extracts before and after induction; lane 3, supernatants of E. coli extracts; lane 4, PA27 after dialysis; ( B ) Substrate specificity of PA27 was investigated towards different p -NP esters; ( C ) pH stability of PA27; ( D ) Organic solvent-stable properties of PA27.
    Chemicals Escherichia Coli Strains, supplied by Stratagene, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/chemicals escherichia coli strains/product/Stratagene
    Average 86 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    chemicals escherichia coli strains - by Bioz Stars, 2021-06
    86/100 stars
      Buy from Supplier

    86
    Stratagene e coli bl21 codonplus ril
    Western blot analyses of the 3CD precursor and its derivatives. Ten micrograms of the proteins from E. coli <t>BL21-CodonPlus-RIL</t> cells harboring the wild-type or mutant pUC3CD plasmid were separated by SDS-PAGE, except that 50 μg of proteins was used for the 3CD-ΔN8 and 3CD-ΔN11 mutants, followed by electroblotting. Relevant proteins were detected by antiprotease antiserum (A) or antipolymerase antiserum (B). Arrows in panel A indicate the 3C, 3C-ΔN5, or 3C-ΔN8 fragments, and those in panel B indicate the 3D RNA polymerase fragments.
    E Coli Bl21 Codonplus Ril, supplied by Stratagene, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/e coli bl21 codonplus ril/product/Stratagene
    Average 86 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    e coli bl21 codonplus ril - by Bioz Stars, 2021-06
    86/100 stars
      Buy from Supplier

    Image Search Results


    SDS gel electrophoretic pattern of recombinant AtSULT202B7 at different stages during purification . Samples were subjected to SDS – PAGE, followed by Coomassie blue staining. Lane 1, molecular weight markers; lane 2, BL21 Escherichia coli homogenate

    Journal: Journal of Biochemistry

    Article Title: Identification of a novel flavonoid glycoside sulfotransferase in Arabidopsis thaliana

    doi: 10.1093/jb/mvt102

    Figure Lengend Snippet: SDS gel electrophoretic pattern of recombinant AtSULT202B7 at different stages during purification . Samples were subjected to SDS – PAGE, followed by Coomassie blue staining. Lane 1, molecular weight markers; lane 2, BL21 Escherichia coli homogenate

    Article Snippet: 7-Hydroxyflavone was purchased from Tokyo Kasei Kogyo Co., Ltd. Quercetin-7-glucoside was a product of Apin Chemical Ltd. Quercetin-3-rhamnoside, 3′-hydroxyflavone and 4′-hydroxyflavone were obtained from Indofine Chemical. pBluescript II SK (+) vector, XL1-Blue MRF’ and BL21 Escherichia coli host strain were obtained from Stratagene. pGEX-4 T-1 prokaryotic GST fusion vectors and glutathione sepharose 4B were from GE Healthcare Biosciences.

    Techniques: SDS-Gel, Recombinant, Purification, SDS Page, Staining, Molecular Weight

    HPTLC chromatogram of total lipid extracts from phage isolates. Lane 1: Escherichia coli BL21 positive control, lane 2: wild-type phage T7; lane 3: mutant phage T7::PhoE. Arrow head indicates the lipid species that is particularly enriched in the T7::PhoE mutant.

    Journal: Scientific Reports

    Article Title: Genetically manipulated phages with improved pH resistance for oral administration in veterinary medicine

    doi: 10.1038/srep39235

    Figure Lengend Snippet: HPTLC chromatogram of total lipid extracts from phage isolates. Lane 1: Escherichia coli BL21 positive control, lane 2: wild-type phage T7; lane 3: mutant phage T7::PhoE. Arrow head indicates the lipid species that is particularly enriched in the T7::PhoE mutant.

    Article Snippet: The phage host was E. coli BL21 (Stratagene).

    Techniques: High Performance Thin Layer Chromatography, Positive Control, Mutagenesis

    ( A ) SDS-PAGE analysis of PA27. Lane M, marker, lane 1 2; crude Escherichia coli extracts before and after induction; lane 3, supernatants of E. coli extracts; lane 4, PA27 after dialysis; ( B ) Substrate specificity of PA27 was investigated towards different p -NP esters; ( C ) pH stability of PA27; ( D ) Organic solvent-stable properties of PA27.

    Journal: Molecules

    Article Title: Identification, Characterization, and Immobilization of an Organic Solvent-Stable Alkaline Hydrolase (PA27) from Pseudomonas aeruginosa MH38

    doi: 10.3390/molecules190914396

    Figure Lengend Snippet: ( A ) SDS-PAGE analysis of PA27. Lane M, marker, lane 1 2; crude Escherichia coli extracts before and after induction; lane 3, supernatants of E. coli extracts; lane 4, PA27 after dialysis; ( B ) Substrate specificity of PA27 was investigated towards different p -NP esters; ( C ) pH stability of PA27; ( D ) Organic solvent-stable properties of PA27.

    Article Snippet: Bacterial Strains, Reagents, and Chemicals Escherichia coli strains (DH5α and BL21 (DE3)) were obtained from Stratagene (La Jolla, CA, USA) and Merck Millipore (Darmstadt, Germany), respectively.

    Techniques: SDS Page, Marker

    Western blot analyses of the 3CD precursor and its derivatives. Ten micrograms of the proteins from E. coli BL21-CodonPlus-RIL cells harboring the wild-type or mutant pUC3CD plasmid were separated by SDS-PAGE, except that 50 μg of proteins was used for the 3CD-ΔN8 and 3CD-ΔN11 mutants, followed by electroblotting. Relevant proteins were detected by antiprotease antiserum (A) or antipolymerase antiserum (B). Arrows in panel A indicate the 3C, 3C-ΔN5, or 3C-ΔN8 fragments, and those in panel B indicate the 3D RNA polymerase fragments.

    Journal: Journal of Virology

    Article Title: Identification of Active-Site Amino Acid Residues in the Chiba Virus 3C-Like Protease

    doi: 10.1128/JVI.76.12.5949-5958.2002

    Figure Lengend Snippet: Western blot analyses of the 3CD precursor and its derivatives. Ten micrograms of the proteins from E. coli BL21-CodonPlus-RIL cells harboring the wild-type or mutant pUC3CD plasmid were separated by SDS-PAGE, except that 50 μg of proteins was used for the 3CD-ΔN8 and 3CD-ΔN11 mutants, followed by electroblotting. Relevant proteins were detected by antiprotease antiserum (A) or antipolymerase antiserum (B). Arrows in panel A indicate the 3C, 3C-ΔN5, or 3C-ΔN8 fragments, and those in panel B indicate the 3D RNA polymerase fragments.

    Article Snippet: E. coli BL21-CodonPlus-RIL was transformed with each of the wild-type pUCHis3BC plasmids, mutant pUCHis3BC plasmids, or pUC3CD derivatives.

    Techniques: Western Blot, Mutagenesis, Plasmid Preparation, SDS Page

    Western blot analyses of alanine-scanning mutants of the His-3BC constructs. Ten micrograms of the proteins from E. coli BL21-CodonPlus-RIL cells harboring the wild-type or mutant pUCHis3BC plasmid were separated by SDS-PAGE, followed by electroblotting. Relevant proteins were detected by antiprotease antiserum (A), or anti-His monoclonal antibody (B). Mutations were represented by using one-letter codes of amino acids. Numbers indicate the positions of amino acid residues. Letters preceding the number and following the number indicate the wild-type amino acid and the introduced amino acid, respectively.

    Journal: Journal of Virology

    Article Title: Identification of Active-Site Amino Acid Residues in the Chiba Virus 3C-Like Protease

    doi: 10.1128/JVI.76.12.5949-5958.2002

    Figure Lengend Snippet: Western blot analyses of alanine-scanning mutants of the His-3BC constructs. Ten micrograms of the proteins from E. coli BL21-CodonPlus-RIL cells harboring the wild-type or mutant pUCHis3BC plasmid were separated by SDS-PAGE, followed by electroblotting. Relevant proteins were detected by antiprotease antiserum (A), or anti-His monoclonal antibody (B). Mutations were represented by using one-letter codes of amino acids. Numbers indicate the positions of amino acid residues. Letters preceding the number and following the number indicate the wild-type amino acid and the introduced amino acid, respectively.

    Article Snippet: E. coli BL21-CodonPlus-RIL was transformed with each of the wild-type pUCHis3BC plasmids, mutant pUCHis3BC plasmids, or pUC3CD derivatives.

    Techniques: Western Blot, Construct, Mutagenesis, Plasmid Preparation, SDS Page