tide Search Results


anticyp17a1  (Santa Cruz Biotechnology)
92
Santa Cruz Biotechnology anticyp17a1
Anticyp17a1, supplied by Santa Cruz Biotechnology, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/Tide+Quencher+2+alkyne/10__1530_slash_rep___24___0239-65-42-45
Average 92 stars, based on 1 article reviews
anticyp17a1 - by Bioz Stars, 2026-10
92/100 stars
  Buy from Supplier
irs1 peptide  (BPS Bioscience)
94
BPS Bioscience irs1 peptide
Irs1 Peptide, supplied by BPS Bioscience, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/IRS1-tide/pm40640547-373-72-76
Average 94 stars, based on 1 article reviews
irs1 peptide - by Bioz Stars, 2026-10
94/100 stars
  Buy from Supplier
tracking indels decomposition (tide) (tide v 2.0.1  (Desktop Genetics)
90
Desktop Genetics tracking indels decomposition (tide) (tide v 2.0.1
Tracking Indels Decomposition (Tide) (Tide V 2.0.1, supplied by Desktop Genetics, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/tide+analysis/bio_rxiv__2020__01__29__918037-327-13-16
Average 90 stars, based on 1 article reviews
tracking indels decomposition (tide) (tide v 2.0.1 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
alprostadil  (Beijing Tide Pharmaceutical)
90
Beijing Tide Pharmaceutical alprostadil
Alprostadil, supplied by Beijing Tide Pharmaceutical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/alprostadil/10__37360_slash_blacpma__24__23__5__52-37-52-77
Average 90 stars, based on 1 article reviews
alprostadil - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
pge 1  (Beijing Tide Pharmaceutical)
90
Beijing Tide Pharmaceutical pge 1
Pge 1, supplied by Beijing Tide Pharmaceutical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/pge1/pmc07218546-95-4-8
Average 90 stars, based on 1 article reviews
pge 1 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
flurbiprofen axetil  (Beijing Tide Pharmaceutical)
90
Beijing Tide Pharmaceutical flurbiprofen axetil
Flurbiprofen Axetil, supplied by Beijing Tide Pharmaceutical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/flurbiprofen+axetil/pmc07923454-80-9-14
Average 90 stars, based on 1 article reviews
flurbiprofen axetil - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
beraprost sodium tablets  (Beijing Tide Pharmaceutical)
90
Beijing Tide Pharmaceutical beraprost sodium tablets
Comparisons of <t> pulmonary arterial </t> <t> hypertension-associated </t> indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.
Beraprost Sodium Tablets, supplied by Beijing Tide Pharmaceutical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/beraprost+sodium+tablets/pmc07869411-51-8-17
Average 90 stars, based on 1 article reviews
beraprost sodium tablets - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
tide gauge station  (SATAKE)
90
SATAKE tide gauge station
Comparisons of <t> pulmonary arterial </t> <t> hypertension-associated </t> indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.
Tide Gauge Station, supplied by SATAKE, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/tide+gauge/10__1186_slash_s40562___017___0097___0-89-5-20
Average 90 stars, based on 1 article reviews
tide gauge station - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
fluorescein—tide quenchertm 2  (AAT Bioquest)
90
AAT Bioquest fluorescein—tide quenchertm 2
Comparisons of <t> pulmonary arterial </t> <t> hypertension-associated </t> indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.
Fluorescein—Tide Quenchertm 2, supplied by AAT Bioquest, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/fluorescein+tide+quenchertm+2/us09382574-204-28-31
Average 90 stars, based on 1 article reviews
fluorescein—tide quenchertm 2 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
cmp tide fluortm 2  (AAT Bioquest)
90
AAT Bioquest cmp tide fluortm 2
Comparisons of <t> pulmonary arterial </t> <t> hypertension-associated </t> indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.
Cmp Tide Fluortm 2, supplied by AAT Bioquest, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/cmp+tide+fluortm+2/pmc08949359-106-13-17
Average 90 stars, based on 1 article reviews
cmp tide fluortm 2 - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
pdk1-tide (acetyl-ktfctgtpeylapevrreprilseeeqemfrdyiadwc)  (21st Century Biochemicals)
90
21st Century Biochemicals pdk1-tide (acetyl-ktfctgtpeylapevrreprilseeeqemfrdyiadwc)
Comparisons of <t> pulmonary arterial </t> <t> hypertension-associated </t> indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.
Pdk1 Tide (Acetyl Ktfctgtpeylapevrreprilseeeqemfrdyiadwc), supplied by 21st Century Biochemicals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/pdk1+tide/pmc02525508-129-0-7
Average 90 stars, based on 1 article reviews
pdk1-tide (acetyl-ktfctgtpeylapevrreprilseeeqemfrdyiadwc) - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier
flurbiprofen patch  (Beijing Tide Pharmaceutical)
90
Beijing Tide Pharmaceutical flurbiprofen patch
Intergroup comparison of general information.
Flurbiprofen Patch, supplied by Beijing Tide Pharmaceutical, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/tide/flurbiprofen+patch/pmc12003408-99-8-10
Average 90 stars, based on 1 article reviews
flurbiprofen patch - by Bioz Stars, 2026-10
90/100 stars
  Buy from Supplier

Image Search Results


Comparisons of pulmonary arterial hypertension-associated indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.

Journal: Medical Science Monitor : International Medical Journal of Experimental and Clinical Research

Article Title: Efficacy of Beraprost Sodium Combined with Sildenafil and Its Effects on Vascular Endothelial Function and Inflammation in Patients Experiencing Left Heart Failure Complicated with Pulmonary Arterial Hypertension

doi: 10.12659/MSM.928413

Figure Lengend Snippet: Comparisons of pulmonary arterial hypertension-associated indicators at 3 months after treatment between the 2 groups (χ̆± s ). Observation group: beraprost sodium combined with sildenafil; control group: beraprost sodium only.

Article Snippet: For the special treatment of heart failure and pulmonary arterial hypertension, beraprost sodium tablets (40 μg each; Beijing Tide Pharmaceutical Co., Ltd., Beijing, China, NMP no. H20083589, batch no. 201711TH125) were orally taken 3 times daily after meals in the control group, whereas sildenafil citrate (20 mg each; Pfizer Inc., New York, NY, USA, NMP no. H20020528, batch no. 20171206) was orally administered 3 times daily in the observation group in addition to the treatment in the control group.

Techniques: Control

Intergroup comparison of general information.

Journal: Frontiers in Pharmacology

Article Title: Transdermal delivery of traditional Chinese medicine patch vs. NSAIDs patch for alleviating inflammation and relieving pain for early-stage knee osteoarthritis: a retrospective case control study

doi: 10.3389/fphar.2025.1549883

Figure Lengend Snippet: Intergroup comparison of general information.

Article Snippet: Patients in flurbiprofen patch group were treated with flurbiprofen patch (Beijing Tide Pharmaceutical) to treat the affected area one patch/day, with continuous treatment for 14 days.

Techniques: Comparison

Intergroup comparison of VAS score before and after treatment.

Journal: Frontiers in Pharmacology

Article Title: Transdermal delivery of traditional Chinese medicine patch vs. NSAIDs patch for alleviating inflammation and relieving pain for early-stage knee osteoarthritis: a retrospective case control study

doi: 10.3389/fphar.2025.1549883

Figure Lengend Snippet: Intergroup comparison of VAS score before and after treatment.

Article Snippet: Patients in flurbiprofen patch group were treated with flurbiprofen patch (Beijing Tide Pharmaceutical) to treat the affected area one patch/day, with continuous treatment for 14 days.

Techniques: Comparison

Intergroup comparison of ESR before and after treatment.

Journal: Frontiers in Pharmacology

Article Title: Transdermal delivery of traditional Chinese medicine patch vs. NSAIDs patch for alleviating inflammation and relieving pain for early-stage knee osteoarthritis: a retrospective case control study

doi: 10.3389/fphar.2025.1549883

Figure Lengend Snippet: Intergroup comparison of ESR before and after treatment.

Article Snippet: Patients in flurbiprofen patch group were treated with flurbiprofen patch (Beijing Tide Pharmaceutical) to treat the affected area one patch/day, with continuous treatment for 14 days.

Techniques: Comparison

Intergroup comparison of TNF-α before and after treatment.

Journal: Frontiers in Pharmacology

Article Title: Transdermal delivery of traditional Chinese medicine patch vs. NSAIDs patch for alleviating inflammation and relieving pain for early-stage knee osteoarthritis: a retrospective case control study

doi: 10.3389/fphar.2025.1549883

Figure Lengend Snippet: Intergroup comparison of TNF-α before and after treatment.

Article Snippet: Patients in flurbiprofen patch group were treated with flurbiprofen patch (Beijing Tide Pharmaceutical) to treat the affected area one patch/day, with continuous treatment for 14 days.

Techniques: Comparison

Intergroup comparison of mild allergy of the joint after treatment.

Journal: Frontiers in Pharmacology

Article Title: Transdermal delivery of traditional Chinese medicine patch vs. NSAIDs patch for alleviating inflammation and relieving pain for early-stage knee osteoarthritis: a retrospective case control study

doi: 10.3389/fphar.2025.1549883

Figure Lengend Snippet: Intergroup comparison of mild allergy of the joint after treatment.

Article Snippet: Patients in flurbiprofen patch group were treated with flurbiprofen patch (Beijing Tide Pharmaceutical) to treat the affected area one patch/day, with continuous treatment for 14 days.

Techniques: Comparison