90
|
Auspep Pty
fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide Fluorescein Isothiocyanate (Fitc)Labelled D Tat Transporter Peptide D Tatfitc Transporter Peptide, supplied by Auspep Pty, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide/product/Auspep Pty Average 90 stars, based on 1 article reviews
fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Genemed Synthesis
peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek Peptides α1 Tat Fitc Ygrkkrrqrrrwklgffkrplkkkmek, supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek/product/Genemed Synthesis Average 90 stars, based on 1 article reviews
peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Cambridge Bioscience
tat-fitc (sequence 47–57) Tat Fitc (Sequence 47–57), supplied by Cambridge Bioscience, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc (sequence 47–57)/product/Cambridge Bioscience Average 90 stars, based on 1 article reviews
tat-fitc (sequence 47–57) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
ANYGEN Co
synthetic tat-fitc peptide Synthetic Tat Fitc Peptide, supplied by ANYGEN Co, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/synthetic tat-fitc peptide/product/ANYGEN Co Average 90 stars, based on 1 article reviews
synthetic tat-fitc peptide - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
AnaSpec
tat-fitc peptide Tat Fitc Peptide, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc peptide/product/AnaSpec Average 90 stars, based on 1 article reviews
tat-fitc peptide - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
ChinaPeptides
tat–fitc z-gggggrkkrrqrrrgyk-fitc Tat–Fitc Z Gggggrkkrrqrrrgyk Fitc, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat–fitc z-gggggrkkrrqrrrgyk-fitc/product/ChinaPeptides Average 90 stars, based on 1 article reviews
tat–fitc z-gggggrkkrrqrrrgyk-fitc - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Ontores Biotechnologies Inc
tat-fitc sequence (fitc-acp-rkkrrqrrr Tat Fitc Sequence (Fitc Acp Rkkrrqrrr, supplied by Ontores Biotechnologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc sequence (fitc-acp-rkkrrqrrr/product/Ontores Biotechnologies Inc Average 90 stars, based on 1 article reviews
tat-fitc sequence (fitc-acp-rkkrrqrrr - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
AnaSpec
tat-fitc #27043 Tat Fitc #27043, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc #27043/product/AnaSpec Average 90 stars, based on 1 article reviews
tat-fitc #27043 - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Genemed Synthesis
fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc) Fluorescein Labeled Tat (Grkkrrqrrrppqckfitc; Tat Fitc), supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc)/product/Genemed Synthesis Average 90 stars, based on 1 article reviews
fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc) - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
JEOL
tat-fitc-sinps Tat Fitc Sinps, supplied by JEOL, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc-sinps/product/JEOL Average 90 stars, based on 1 article reviews
tat-fitc-sinps - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
AnaSpec
nh2−tat−fitc Nh2−Tat−Fitc, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/nh2−tat−fitc/product/AnaSpec Average 90 stars, based on 1 article reviews
nh2−tat−fitc - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |
90
|
Thoren Caging Systems
tat-fitc Tat Fitc, supplied by Thoren Caging Systems, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/tat-fitc/product/Thoren Caging Systems Average 90 stars, based on 1 article reviews
tat-fitc - by Bioz Stars,
2026-03
90/100 stars
|
Buy from Supplier |