tat-fitc Search Results


90
Auspep Pty fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide
Fluorescein Isothiocyanate (Fitc)Labelled D Tat Transporter Peptide D Tatfitc Transporter Peptide, supplied by Auspep Pty, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide/product/Auspep Pty
Average 90 stars, based on 1 article reviews
fluorescein isothiocyanate (fitc)labelled d-tat transporter peptide d-tatfitc transporter peptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Genemed Synthesis peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek
Peptides α1 Tat Fitc Ygrkkrrqrrrwklgffkrplkkkmek, supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek/product/Genemed Synthesis
Average 90 stars, based on 1 article reviews
peptides α1-tat fitc-ygrkkrrqrrrwklgffkrplkkkmek - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Cambridge Bioscience tat-fitc (sequence 47–57)
Tat Fitc (Sequence 47–57), supplied by Cambridge Bioscience, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc (sequence 47–57)/product/Cambridge Bioscience
Average 90 stars, based on 1 article reviews
tat-fitc (sequence 47–57) - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ANYGEN Co synthetic tat-fitc peptide
Synthetic Tat Fitc Peptide, supplied by ANYGEN Co, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/synthetic tat-fitc peptide/product/ANYGEN Co
Average 90 stars, based on 1 article reviews
synthetic tat-fitc peptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
AnaSpec tat-fitc peptide
Tat Fitc Peptide, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc peptide/product/AnaSpec
Average 90 stars, based on 1 article reviews
tat-fitc peptide - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
ChinaPeptides tat–fitc z-gggggrkkrrqrrrgyk-fitc
Tat–Fitc Z Gggggrkkrrqrrrgyk Fitc, supplied by ChinaPeptides, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat–fitc z-gggggrkkrrqrrrgyk-fitc/product/ChinaPeptides
Average 90 stars, based on 1 article reviews
tat–fitc z-gggggrkkrrqrrrgyk-fitc - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Ontores Biotechnologies Inc tat-fitc sequence (fitc-acp-rkkrrqrrr
Tat Fitc Sequence (Fitc Acp Rkkrrqrrr, supplied by Ontores Biotechnologies Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc sequence (fitc-acp-rkkrrqrrr/product/Ontores Biotechnologies Inc
Average 90 stars, based on 1 article reviews
tat-fitc sequence (fitc-acp-rkkrrqrrr - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
AnaSpec tat-fitc #27043
Tat Fitc #27043, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc #27043/product/AnaSpec
Average 90 stars, based on 1 article reviews
tat-fitc #27043 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Genemed Synthesis fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc)
Fluorescein Labeled Tat (Grkkrrqrrrppqckfitc; Tat Fitc), supplied by Genemed Synthesis, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc)/product/Genemed Synthesis
Average 90 stars, based on 1 article reviews
fluorescein-labeled tat (grkkrrqrrrppqckfitc; tat-fitc) - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
JEOL tat-fitc-sinps
Tat Fitc Sinps, supplied by JEOL, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc-sinps/product/JEOL
Average 90 stars, based on 1 article reviews
tat-fitc-sinps - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
AnaSpec nh2−tat−fitc
Nh2−Tat−Fitc, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/nh2−tat−fitc/product/AnaSpec
Average 90 stars, based on 1 article reviews
nh2−tat−fitc - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Thoren Caging Systems tat-fitc
Tat Fitc, supplied by Thoren Caging Systems, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tat-fitc/product/Thoren Caging Systems
Average 90 stars, based on 1 article reviews
tat-fitc - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

Image Search Results