sidd Search Results


atcc 46645 sidd  (ATCC)
96
ATCC atcc 46645 sidd
Fungal strains utilized in this study.
Atcc 46645 Sidd, supplied by ATCC, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sidd/pmc03708856-6-4-3?v=ATCC
Average 96 stars, based on 1 article reviews
atcc 46645 sidd - by Bioz Stars, 2026-07
96/100 stars
  Buy from Supplier
chi-square test  (CH Instruments)
90
CH Instruments chi-square test
Comparison of anthropometric, biochemical, and medical characteristics in the three optimal k-value clusters.
Chi Square Test, supplied by CH Instruments, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/sidd/pmc11366003-137-12-23?v=CH+Instruments
Average 90 stars, based on 1 article reviews
chi-square test - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier
h-siddiggalsk^-oh  (Biosynth Carbosynth)
N/A
   Buy from Supplier
h-cyssdptgaltedsiddtflpvpeyinqsvpk-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
h-cessiddlmk-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
h-gqsiddmipaqk-oh  (Biosynth Carbosynth)
N/A
   Buy from Supplier
h-(py)ssdptgaltedsiddtflpvpeyinqsvpk-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
ac-yreesiddgc-nh2  (Biosynth Carbosynth)
N/A
   Buy from Supplier
h-yssdptgaltedsiddtflpvpeyinqsvpk-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
h-nskmalnslnsidda-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
h-lnsiddaqltriapp-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier
h-siddevveqr-oh  (Biosynth Carbosynth)
N/A
Catalog peptide; in stock; >95% purity
   Buy from Supplier

Image Search Results


Fungal strains utilized in this study.

Journal: PLoS Pathogens

Article Title: Targeting Iron Acquisition Blocks Infection with the Fungal Pathogens Aspergillus fumigatus and Fusarium oxysporum

doi: 10.1371/journal.ppat.1003436

Figure Lengend Snippet: Fungal strains utilized in this study.

Article Snippet: Δ sidD , ATCC 46645- sidD::hph , No fusarinine C or TAFC.

Techniques: Fluorescence

Comparison of anthropometric, biochemical, and medical characteristics in the three optimal k-value clusters.

Journal: Scientific Reports

Article Title: Comparison of clustering and phenotyping approaches for subclassification of type 2 diabetes and its association with remission in Indian population

doi: 10.1038/s41598-024-71126-7

Figure Lengend Snippet: Comparison of anthropometric, biochemical, and medical characteristics in the three optimal k-value clusters.

Article Snippet: The remission rates were highest in the MOD group, followed by the SIDD and SIRD groups, with marginal significance ( p = 0.061, Chi-Square test).

Techniques: Comparison

Sankey diagrams showing the flow of patients between the identified clusters and sub-phenotypes; SIDD: severe insulin-deficient diabetes; SIRD: severe insulin-resistant diabetes; MOD: mild obesity-related diabetes.

Journal: Scientific Reports

Article Title: Comparison of clustering and phenotyping approaches for subclassification of type 2 diabetes and its association with remission in Indian population

doi: 10.1038/s41598-024-71126-7

Figure Lengend Snippet: Sankey diagrams showing the flow of patients between the identified clusters and sub-phenotypes; SIDD: severe insulin-deficient diabetes; SIRD: severe insulin-resistant diabetes; MOD: mild obesity-related diabetes.

Article Snippet: The remission rates were highest in the MOD group, followed by the SIDD and SIRD groups, with marginal significance ( p = 0.061, Chi-Square test).

Techniques: