|
Grameen Danone Foods Ltd
sbm-grameen Sbm Grameen, supplied by Grameen Danone Foods Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm-grameen/product/Grameen Danone Foods Ltd Average 90 stars, based on 1 article reviews
sbm-grameen - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
SourceForge net
source-based morphometry sbm v 1.0b Source Based Morphometry Sbm V 1.0b, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/source-based morphometry sbm v 1.0b/product/SourceForge net Average 90 stars, based on 1 article reviews
source-based morphometry sbm v 1.0b - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
Chemie GmbH
t-sbm T Sbm, supplied by Chemie GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/t-sbm/product/Chemie GmbH Average 90 stars, based on 1 article reviews
t-sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
OptiGen LLC
sbm or sr-u optigen ii Sbm Or Sr U Optigen Ii, supplied by OptiGen LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm or sr-u optigen ii/product/OptiGen LLC Average 90 stars, based on 1 article reviews
sbm or sr-u optigen ii - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
Solae LLC
conventional dehulled sbm ![]() Conventional Dehulled Sbm, supplied by Solae LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/conventional dehulled sbm/product/Solae LLC Average 90 stars, based on 1 article reviews
conventional dehulled sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
PROACT Medical Ltd
sbm ![]() Sbm, supplied by PROACT Medical Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm/product/PROACT Medical Ltd Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
FUJIFILM
salbutamol (sbm ![]() Salbutamol (Sbm, supplied by FUJIFILM, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/salbutamol (sbm/product/FUJIFILM Average 90 stars, based on 1 article reviews
salbutamol (sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
DeGussa Corporation
sbm ![]() Sbm, supplied by DeGussa Corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm/product/DeGussa Corporation Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
SBM Life Science
bioadvanced insect, disease, and mite control ![]() Bioadvanced Insect, Disease, And Mite Control, supplied by SBM Life Science, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/bioadvanced insect, disease, and mite control/product/SBM Life Science Average 90 stars, based on 1 article reviews
bioadvanced insect, disease, and mite control - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
Genebiotech Co Ltd
sbm ![]() Sbm, supplied by Genebiotech Co Ltd, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm/product/Genebiotech Co Ltd Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
Biopeptide
human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 ) ![]() Human Dab2 Sbm ( 24 Skkekkkgpektdeyllarfkgdgvkykakligid 58 ), supplied by Biopeptide, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 )/product/Biopeptide Average 90 stars, based on 1 article reviews
human dab2 sbm ( 24 skkekkkgpektdeyllarfkgdgvkykakligid 58 ) - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
|
Rocha labs
sbm ![]() Sbm, supplied by Rocha labs, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/result/sbm/product/Rocha labs Average 90 stars, based on 1 article reviews
sbm - by Bioz Stars,
2026-06
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Journal of Animal Science
Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter
doi: 10.1093/jas/sky010
Figure Lengend Snippet: Analyzed nutrient composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled
Techniques: Starch
Journal: Journal of Animal Science
Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter
doi: 10.1093/jas/sky010
Figure Lengend Snippet: Analyzed amino acid composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled
Techniques:
Journal: Journal of Animal Science
Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter
doi: 10.1093/jas/sky010
Figure Lengend Snippet: Analyzed mineral composition of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin, as-fed basis
Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled
Techniques:
Journal: Journal of Animal Science
Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter
doi: 10.1093/jas/sky010
Figure Lengend Snippet: Bulk density, swelling, WBC, and viscosity of corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin
Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled
Techniques: Viscosity
Journal: Journal of Animal Science
Article Title: Analysis for low-molecular-weight carbohydrates is needed to account for all energy-contributing nutrients in some feed ingredients, but physical characteristics do not predict in vitro digestibility of dry matter
doi: 10.1093/jas/sky010
Figure Lengend Snippet: IVAID and IVATTD of DM and OM in corn, wheat, soybean meal, canola meal, distillers dried grains with solubles, corn germ meal, copra expellers, sugar beet pulp, synthetic cellulose, and pectin
Article Snippet: Corn (Premier Cooperative, Philo, IL) and wheat (Siemers, Teutopolis, IL) were the 2 cereal grains used, and conventional dehulled
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Article Snippet: The
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Article Snippet: The
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: Differences in the rumen microbiota were compared using permutational multivariate analysis of variance. PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Article Snippet: The
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: The visualized taxa include those with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.5% in at least one treatment. UCG represents an uncultured genus-level group, while UG denotes an unclassified genus. Others represent bacteria with an occurrence rate of < 30% and a relative abundance of < 0.5%. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal.
Article Snippet: The
Techniques: Bacteria
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: Only major phyla with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic phyla, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different phyla based on the p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different phyla. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.
Article Snippet: The
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: Only major genera with an occurrence rate of ≥ 30% and a relative abundance of ≥ 0.1% in at least one treatment were included in the evaluation. (A) Relative abundance of prokaryotic genera, represented as mean ± standard error. Screening p -values were obtained using ANCOM-BC’s global test, with only significantly different genera based on p -values visualized. (B)–(G) Pairwise comparisons: (B) SBM vs. HSBM, (C) SBM vs. CSBM, (D) SBM vs. HCSBM, (E) HSBM vs. CSBM, (F) HSBM vs. HCSBM, and (G) CSBM vs. HCSBM. Data are shown as log fold change ± 95% confidence interval, with red symbols indicating significantly different genera, while a blue symbol indicates a statistical tendency. SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction.
Article Snippet: The
Techniques:
Journal: Journal of Animal Science and Technology
Article Title: Effects of citric acid and heat-treated soybean meal on rumen fermentation characteristics, methane emissions, and microbiota: an in vitro study
doi: 10.5187/jast.2024.e102
Figure Lengend Snippet: (A) PCA plot based on KEGG orthologs. Only primary KEGG modules with a relative abundance of ≥ 0.01% in at least one treatment were assessed using ANCOM-BC. (B)-(G) Differentially enriched KEGG modules Data are shown as log-fold changes with 95% confidence intervals. Red symbols indicate significantly different KEGG modules, whereas blue symbols denote statistical tendencies. KEGG, Kyoto Encyclopedia of Genes and Genomes; PC, principal component; SBM, untreated soybean meal; HSBM, heat-treated soybean meal; CSBM, citric acid-treated soybean meal; HCSBM, heat and citric acid-treated soybean meal; ANCOM-BC, analysis of the composition of microbiomes with bias correction; PCA, principal component analysis.
Article Snippet: The
Techniques: