|
Proteintech
polr2h proteintech rabbit Polr2h Proteintech Rabbit, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/polr2h/pmc12043920__41598_2025_97727_MOESM1_ESM-11-18-19?v=Proteintech Average 93 stars, based on 1 article reviews
polr2h proteintech rabbit - by Bioz Stars,
2026-08
93/100 stars
|
Buy from Supplier |
|
TranScrip Partners
rna pol ii subunits polr2g, polr2h, pol2l Rna Pol Ii Subunits Polr2g, Polr2h, Pol2l, supplied by TranScrip Partners, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/polr2h/pmc05946721__mmc4-128-19-20?v=TranScrip+Partners Average 90 stars, based on 1 article reviews
rna pol ii subunits polr2g, polr2h, pol2l - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
WuXi AppTec
rabbit-anti-polr2h (rpab3 ![]() Rabbit Anti Polr2h (Rpab3, supplied by WuXi AppTec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/polr2h/pmc11105367-112-33-36?v=WuXi+AppTec Average 90 stars, based on 1 article reviews
rabbit-anti-polr2h (rpab3 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Abnova
anti polr2h antibody ![]() Anti Polr2h Antibody, supplied by Abnova, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/polr2h/pm22149079-30-7-9?v=Abnova Average 90 stars, based on 1 article reviews
anti polr2h antibody - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Gallus BioPharmaceuticals
polr2h gene ![]() Polr2h Gene, supplied by Gallus BioPharmaceuticals, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/polr2h/pm23070920-26-8-28?v=Gallus+BioPharmaceuticals Average 90 stars, based on 1 article reviews
polr2h gene - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Polr2h Rat 3 unique 27mer siRNA duplexes 2 nmol each
|
Buy from Supplier |
|
POLR2H mouse monoclonal antibody clone OTI1C10 Biotinylated
|
Buy from Supplier |
|
Lenti ORF clone of Polr2h Myc DDK tagged Mouse polymerase RNA II DNA directed polypeptide H cDNA clone MGC 103049 IMAGE 5042770
|
Buy from Supplier |
|
POLR2H antibody was raised using the N terminal of POLR2H corresponding to a region with amino acids DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE. Rabbit polyclonal POLR2H antibody raised against the N terminal of POLR2H.
|
Buy from Supplier |
|
POLR2H Human 4 unique 29mer shRNA constructs in lentiviral GFP vector
|
Buy from Supplier |
|
Lenti ORF particles POLR2H Myc DDK tagged Human polymerase RNA II DNA directed polypeptide H POLR2H 200ul 10 7 TU mL
|
Buy from Supplier |
Image Search Results
Journal: Cellular and Molecular Life Sciences: CMLS
Article Title: Dysregulation of a novel miR-1825/TBCB/TUBA4A pathway in sporadic and familial ALS
doi: 10.1007/s00018-018-2873-1
Figure Lengend Snippet: Identification of miR-1825 targets by proteomic and transcriptomic profiling. a Experimental design for miR-1825 target identification. b Representative western blots of HEK293 cells used for densitometric analysis shown in c. c Densitometric quantification of western blots of HEK293 cells 48 h post-transfection with mimic-1825, antimiR-1825 or the corresponding control RNAs. Levels of TBCB (n = 5), CASP3 (n = 5) and RPAB3 (n = 7) were normalized to β-actin. d Hierarchical cluster analysis (average linkage) of all RNAs detected by microarray analysis of HEK293 cells transfected with mimic-1825 or the respective control RNA (mimic-ctrl.; n = 6 biological replicates per condition). e QRT-PCR validation of mRNA levels of proteins found to be downregulated (CASP3, TBCB, RPAB3), unaltered (DDX3, XPO7, PFN1) or upregulated (EDC3, DDX24, CPSF7) upon mimic-1825 transfection by mass spectrometry (n = 6 biological replicates). QRT-PCR measurements were carried out 24 h post-transfection and Ct values were normalized to TBP (bars in c and e indicate mean ± SEM; *p < 0.05, **p < 0.01, ***p < 0.001 in a two-tailed Student’s t test; ns not significant)
Article Snippet: Primary antibodies were rabbit-anti-Caspase3 (#9662, Cell Signaling Technology, 1:1000), rabbit-anti-TBCB (#PA03169A0Rb, Cusabio Life science, 1:1000), rabbit-anti-TUBA4A (# P68366 , Abgent, 1:8000), rabbit-anti-TUBA4A (#ab8374, Abcam, 1:500), mouse-anti-myc tag (9B11, #2276, Cell Signaling Technology, 1:2000),
Techniques: Western Blot, Transfection, Microarray, Quantitative RT-PCR, Mass Spectrometry, Two Tailed Test