90
|
DaVinci Biosciences
icg var3 phlip davinci si surgical system Icg Var3 Phlip Davinci Si Surgical System, supplied by DaVinci Biosciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pm39798775-202-0-5?v=DaVinci+Biosciences Average 90 stars, based on 1 article reviews
icg var3 phlip davinci si surgical system - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
SourceForge net
auto-phlip-ml software Auto Phlip Ml Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc02592929-141-17-22?v=SourceForge+net Average 90 stars, based on 1 article reviews
auto-phlip-ml software - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
SourceForge net
phobia laser scanning microscopy imaging processor (phlip) software Phobia Laser Scanning Microscopy Imaging Processor (Phlip) Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc06999451-113-17-26?v=SourceForge+net Average 90 stars, based on 1 article reviews
phobia laser scanning microscopy imaging processor (phlip) software - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
SourceForge net
phlip software Phlip Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/10__1128_slash_aem__00631___08-144-0-3?v=SourceForge+net Average 90 stars, based on 1 article reviews
phlip software - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
GL Biochem
nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip Nh2 Aeqnpiywaryadwlfttplllldlallvdadegt (Phlip, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pm39558766-375-0-5?v=GL+Biochem Average 90 stars, based on 1 article reviews
nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg) Phlip Peptide (A C Eqnpiywarya D Wlfttpllll D Lallvdadegtg), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc04405778-66-1-25?v=GenScript+corporation Average 90 stars, based on 1 article reviews
phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg) - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
alkynyl-terminated phlip Alkynyl Terminated Phlip, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pm29493121-181-2-22?v=GenScript+corporation Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg Alkynyl Terminated Phlip Sequence “Ceeqqpwaqylellfptetlllewg, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pm29493121-181-8-22?v=GenScript+corporation Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
GL Biochem
phlip-cys Phlip Cys, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc04476257-97-30-36?v=GL+Biochem Average 90 stars, based on 1 article reviews
phlip-cys - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
CS Bio Inc
ph-(low)-insertion peptide (phlip) csbio c Ph (Low) Insertion Peptide (Phlip) Csbio C, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc08924371-48-4-4?v=CS+Bio+Inc Average 90 stars, based on 1 article reviews
ph-(low)-insertion peptide (phlip) csbio c - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
AnaSpec
hylite fluor® 647-conjugated phlip Hylite Fluor® 647 Conjugated Phlip, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc03677567-50-3-17?v=AnaSpec Average 90 stars, based on 1 article reviews
hylite fluor® 647-conjugated phlip - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
90
|
CS Bio Inc
no2a-variant 3 phlip No2a Variant 3 Phlip, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/phlip/pmc07165066-105-0-13?v=CS+Bio+Inc Average 90 stars, based on 1 article reviews
no2a-variant 3 phlip - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |