phlip Search Results


90
DaVinci Biosciences icg var3 phlip davinci si surgical system
Icg Var3 Phlip Davinci Si Surgical System, supplied by DaVinci Biosciences, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pm39798775-202-0-5?v=DaVinci+Biosciences
Average 90 stars, based on 1 article reviews
icg var3 phlip davinci si surgical system - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
SourceForge net auto-phlip-ml software
Auto Phlip Ml Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc02592929-141-17-22?v=SourceForge+net
Average 90 stars, based on 1 article reviews
auto-phlip-ml software - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
SourceForge net phobia laser scanning microscopy imaging processor (phlip) software
Phobia Laser Scanning Microscopy Imaging Processor (Phlip) Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc06999451-113-17-26?v=SourceForge+net
Average 90 stars, based on 1 article reviews
phobia laser scanning microscopy imaging processor (phlip) software - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
SourceForge net phlip software
Phlip Software, supplied by SourceForge net, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/10__1128_slash_aem__00631___08-144-0-3?v=SourceForge+net
Average 90 stars, based on 1 article reviews
phlip software - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GL Biochem nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip
Nh2 Aeqnpiywaryadwlfttplllldlallvdadegt (Phlip, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pm39558766-375-0-5?v=GL+Biochem
Average 90 stars, based on 1 article reviews
nh2-aeqnpiywaryadwlfttplllldlallvdadegt (phlip - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenScript corporation phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg)
Phlip Peptide (A C Eqnpiywarya D Wlfttpllll D Lallvdadegtg), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc04405778-66-1-25?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
phlip peptide (a c eqnpiywarya d wlfttpllll d lallvdadegtg) - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenScript corporation alkynyl-terminated phlip
Alkynyl Terminated Phlip, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pm29493121-181-2-22?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenScript corporation alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg
Alkynyl Terminated Phlip Sequence “Ceeqqpwaqylellfptetlllewg, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pm29493121-181-8-22?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
alkynyl-terminated phlip sequence “ceeqqpwaqylellfptetlllewg - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GL Biochem phlip-cys
Phlip Cys, supplied by GL Biochem, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc04476257-97-30-36?v=GL+Biochem
Average 90 stars, based on 1 article reviews
phlip-cys - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
CS Bio Inc ph-(low)-insertion peptide (phlip) csbio c
Ph (Low) Insertion Peptide (Phlip) Csbio C, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc08924371-48-4-4?v=CS+Bio+Inc
Average 90 stars, based on 1 article reviews
ph-(low)-insertion peptide (phlip) csbio c - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
AnaSpec hylite fluor® 647-conjugated phlip
Hylite Fluor® 647 Conjugated Phlip, supplied by AnaSpec, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc03677567-50-3-17?v=AnaSpec
Average 90 stars, based on 1 article reviews
hylite fluor® 647-conjugated phlip - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
CS Bio Inc no2a-variant 3 phlip
No2a Variant 3 Phlip, supplied by CS Bio Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/phlip/pmc07165066-105-0-13?v=CS+Bio+Inc
Average 90 stars, based on 1 article reviews
no2a-variant 3 phlip - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

Image Search Results