Journal: bioRxiv

Article Title: LRRC33 is a novel binding and regulating protein of TGF-β1 function in human acute myeloid leukemia cells

doi: 10.1101/560763

Figure Lengend Snippet: Data is from Cancer Cell Line Encyclopedia database. (A) LRRC33 has the highest mRNA level in AML cells compared to other cancer cells. The p values are calculated by comparing mRNA level of AML cells to other cells through one-way analysis of variance (ANOVA) in Prism 7 Graphpad software. Error bars indicate the range of mRNA level of all the cell lines in each category. (B) LRRC33 and TGFβ1 mRNA expression are both high in AML cells. AML193 and MV4-11 are two representative cell lines studied in this research. Haemo/Lympo indicates other hematopoietic and lymphatic cells.

Article Snippet: MV4-11 and AML193 cells were obtained from ATCC and were cultured in Iscove’s Modified Dulbecco’s Medium (IMDM) (ThermoFisher Scientific, Waltham, MA) supplemented with 10% fetal bovine serum (FBS), 5 mM L-glutamine, 1% nonessential amino acids, and 5mM penicillin/streptomycin.

Techniques: Software, Expressing

Journal: bioRxiv

Article Title: LRRC33 is a novel binding and regulating protein of TGF-β1 function in human acute myeloid leukemia cells

doi: 10.1101/560763

Figure Lengend Snippet: (A) Flow cytometry of double-staining of fixed and permeabilized AML193 and MV4-11 cells. Cells were stained with Alexa488-conjugated LRRC33 and APC-conjugated pro-TGF-β1 mAbs before and after PMA stimulation. Alexa488- and APC-directly conjugated non-specific IgG were used as control and the control staining are indicated in grey dots. Numbers of double positive cells are shown. (B) LRRC33 and pro-TGF-β1 co-localization visualized by confocal microscopy. Green: anti-LRRC33; Red: anti-pro-TGF-β1; Blue: DAPI staining.

Article Snippet: MV4-11 and AML193 cells were obtained from ATCC and were cultured in Iscove’s Modified Dulbecco’s Medium (IMDM) (ThermoFisher Scientific, Waltham, MA) supplemented with 10% fetal bovine serum (FBS), 5 mM L-glutamine, 1% nonessential amino acids, and 5mM penicillin/streptomycin.

Techniques: Flow Cytometry, Double Staining, Staining, Control, Confocal Microscopy

Journal: bioRxiv

Article Title: LRRC33 is a novel binding and regulating protein of TGF-β1 function in human acute myeloid leukemia cells

doi: 10.1101/560763

Figure Lengend Snippet: The luciferase activity is expressed in relative light units (RLU). Data are presented as the mean and standard deviation of four replicates and is the representative of three independent experiments on different days. (A) MV4-11and (B) AML193 cells, without or with PMA stimulation. (C) For MV4-11 and AML193 cells with PMA stimulation, incubation with 2.5 μg/ml anti-α v integrin mouse mAb 272-17E6 results in decrease of TGF-β1 activation. Non-specific mouse IgG is used as negative control. The p values are calculated by 2-way ANOVA comparisons in Prism 7 Graphpad software. ns: not significant. *: p<0.1, **: p<0.01, ***: p<0.001, ****: p<0.0001

Article Snippet: MV4-11 and AML193 cells were obtained from ATCC and were cultured in Iscove’s Modified Dulbecco’s Medium (IMDM) (ThermoFisher Scientific, Waltham, MA) supplemented with 10% fetal bovine serum (FBS), 5 mM L-glutamine, 1% nonessential amino acids, and 5mM penicillin/streptomycin.

Techniques: Luciferase, Activity Assay, Standard Deviation, Incubation, Activation Assay, Negative Control, Software

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Immunohistochemistry, Western Blot, Immunohistochemical staining, Control, Expressing, Staining

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 4. Identification of alteration of runt‑related transcription factor 1 (RUNX1) protein expression by MALDI‑TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss‑Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identi fied as RUNX1. Inset is the Swiss‑Prot protein score from the Swiss‑Prot database.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Expressing, Mass Spectrometry, Tandem Mass Spectroscopy