aml Search Results


94
ATCC myeloid leukemia aml cell line aml193
Myeloid Leukemia Aml Cell Line Aml193, supplied by ATCC, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/myeloid leukemia aml cell line aml193/product/ATCC
Average 94 stars, based on 1 article reviews
myeloid leukemia aml cell line aml193 - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier

90
Danaher Inc xgen aml cancer panel
Xgen Aml Cancer Panel, supplied by Danaher Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/xgen aml cancer panel/product/Danaher Inc
Average 90 stars, based on 1 article reviews
xgen aml cancer panel - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

94
Proteintech runx1 antibody
FIGURE 8 Brg1 modulated TRPM4 promoter activity by interaction with <t>RUNX1.</t> (A) Predicting the residue label and hydrogen bond length of interaction between Brg1 and RUNX1, and the combination state and surface structure of Brg1 and RUNX1 by Protein Data Bank. (B) Co-immunoprecipitation assays of Brg1 and RUNX1 on the nucleoprotein extracted from neonatal mouse cardiomyocytes. (C) RUNX1 significantly boosted TRPM4 promoter activity. Statistical analysis was performed with two-tailed Student’s t-test. *p < 0.05, **p < 0.01 vs. NC group. n = 8 in each group. (D) Brg1 knockdown significantly decreased the TRPM4 promoter activity. **p < 0.01 vs. Scramble-siRNA group by two-tailed Student’s t-test. n = 6 in each group. (E) Inhibited Brg1 by PFI-3 (10 μM) significantly reduced the TRPM4 promoter activity. **p < 0.01 vs. DMSO group by two-tailed Student’s t-test. n = 6 in each group. (F) RUNX1 knockdown declined the increases in TRPM4 promoter activity caused by Brg1-OE. *p < 0.05, vs. NC group; ##p < 0.01 vs. +Scramble-siRNA by (Continued)
Runx1 Antibody, supplied by Proteintech, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/runx1 antibody/product/Proteintech
Average 94 stars, based on 1 article reviews
runx1 antibody - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier

94
Boster Bio polyclonal anti runx2
(A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of <t>Runx2.</t> *means significant difference.
Polyclonal Anti Runx2, supplied by Boster Bio, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/polyclonal anti runx2/product/Boster Bio
Average 94 stars, based on 1 article reviews
polyclonal anti runx2 - by Bioz Stars, 2026-03
94/100 stars
  Buy from Supplier

93
Proteintech thoc4 aly ref
(A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of <t>Runx2.</t> *means significant difference.
Thoc4 Aly Ref, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/thoc4 aly ref/product/Proteintech
Average 93 stars, based on 1 article reviews
thoc4 aly ref - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

93
Proteintech antibodies against runx1
(A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of <t>Runx2.</t> *means significant difference.
Antibodies Against Runx1, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antibodies against runx1/product/Proteintech
Average 93 stars, based on 1 article reviews
antibodies against runx1 - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

93
DSMZ cell culture human aml cell lines aml 193
EIF3B relative expression in human <t>AML</t> <t>cell</t> lines. EIF3B mRNA relative expression (A) and protein expression (B) were increased in AML-193, OCI-AML2, and KG-1 cell lines compared to human primary BMMC. The comparison of EIF3B mRNA relative expression between human AML cell lines and human primary BMMC was conducted using one-way ANOVA followed by Dunnett’s multiple comparisons test. P < 0.05 was considered significant. NS, non-significant; *P < 0.05, **P < 0.01, ***P < 0.001. EIF3B, eukaryotic translation initiation factor 3 subunit B; AML, acute myeloid leukemia; BMMC, bone marrow mononuclear cells.
Cell Culture Human Aml Cell Lines Aml 193, supplied by DSMZ, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/cell culture human aml cell lines aml 193/product/DSMZ
Average 93 stars, based on 1 article reviews
cell culture human aml cell lines aml 193 - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

93
Proteintech rabbit antibodies against runx3
Fig. 1. The population sizes of TRKB+ and TRKC+ neurons are altered in the P0 miRCKO mice. (A-C) The percentage of TRKB+ neurons was increased in the miRCKO mice. Immunostaining for TRKB on DRG sections of control Wnt1-Cre mice (A) and the miRCKO mice (B) as well as quantification of the percentage of TRKB+ neurons in L3-L5 ganglions (C, n=3, 4). (D) The number of total neurons (ISL1+) in L5 DRG was not altered in the miRCKO mice compared with controls (n=3, 4; not significant). (E-G) The percent of total TRKC neurons were decreased in the miRCKO mice. Double immunostaining for TRKC and <t>RUNX3</t> on DRG sections of Wnt1-Cre mice (E) and miR CKO mice (F), arrow heads in E and F point to NF3 (TRKC+RUNX3-) neurons, inset are higher magnifications of areas outlined in E and F. (G) Quantification of the percentage of total TRKC, TRKC+RUNX3+ (not significant) and TRKC+RUNX3- neurons in L3-L5 ganglions (n=4, 4). Data shown in mean±s.e.m. and analyzed by t-test and P<0.05 is statistically significant. *P<0.05, **P<0.01. Scale bar =µ.
Rabbit Antibodies Against Runx3, supplied by Proteintech, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rabbit antibodies against runx3/product/Proteintech
Average 93 stars, based on 1 article reviews
rabbit antibodies against runx3 - by Bioz Stars, 2026-03
93/100 stars
  Buy from Supplier

90
Boster Bio rabbit polyclonal antibody against runx1
Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 <t>(RUNX1)</t> proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.
Rabbit Polyclonal Antibody Against Runx1, supplied by Boster Bio, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rabbit polyclonal antibody against runx1/product/Boster Bio
Average 90 stars, based on 1 article reviews
rabbit polyclonal antibody against runx1 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Boster Bio pb9157
Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 <t>(RUNX1)</t> proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.
Pb9157, supplied by Boster Bio, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/pb9157/product/Boster Bio
Average 90 stars, based on 1 article reviews
pb9157 - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

90
Boster Bio anti runx2 cbfa1 antibody
Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 <t>(RUNX1)</t> proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.
Anti Runx2 Cbfa1 Antibody, supplied by Boster Bio, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/anti runx2 cbfa1 antibody/product/Boster Bio
Average 90 stars, based on 1 article reviews
anti runx2 cbfa1 antibody - by Bioz Stars, 2026-03
90/100 stars
  Buy from Supplier

92
fluidigm full length
Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 <t>(RUNX1)</t> proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.
Full Length, supplied by fluidigm, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/full length/product/fluidigm
Average 92 stars, based on 1 article reviews
full length - by Bioz Stars, 2026-03
92/100 stars
  Buy from Supplier

Image Search Results


FIGURE 8 Brg1 modulated TRPM4 promoter activity by interaction with RUNX1. (A) Predicting the residue label and hydrogen bond length of interaction between Brg1 and RUNX1, and the combination state and surface structure of Brg1 and RUNX1 by Protein Data Bank. (B) Co-immunoprecipitation assays of Brg1 and RUNX1 on the nucleoprotein extracted from neonatal mouse cardiomyocytes. (C) RUNX1 significantly boosted TRPM4 promoter activity. Statistical analysis was performed with two-tailed Student’s t-test. *p < 0.05, **p < 0.01 vs. NC group. n = 8 in each group. (D) Brg1 knockdown significantly decreased the TRPM4 promoter activity. **p < 0.01 vs. Scramble-siRNA group by two-tailed Student’s t-test. n = 6 in each group. (E) Inhibited Brg1 by PFI-3 (10 μM) significantly reduced the TRPM4 promoter activity. **p < 0.01 vs. DMSO group by two-tailed Student’s t-test. n = 6 in each group. (F) RUNX1 knockdown declined the increases in TRPM4 promoter activity caused by Brg1-OE. *p < 0.05, vs. NC group; ##p < 0.01 vs. +Scramble-siRNA by (Continued)

Journal: Frontiers in pharmacology

Article Title: Brg1 and RUNX1 synergy in regulating TRPM4 channel in mouse cardiomyocytes.

doi: 10.3389/fphar.2024.1494205

Figure Lengend Snippet: FIGURE 8 Brg1 modulated TRPM4 promoter activity by interaction with RUNX1. (A) Predicting the residue label and hydrogen bond length of interaction between Brg1 and RUNX1, and the combination state and surface structure of Brg1 and RUNX1 by Protein Data Bank. (B) Co-immunoprecipitation assays of Brg1 and RUNX1 on the nucleoprotein extracted from neonatal mouse cardiomyocytes. (C) RUNX1 significantly boosted TRPM4 promoter activity. Statistical analysis was performed with two-tailed Student’s t-test. *p < 0.05, **p < 0.01 vs. NC group. n = 8 in each group. (D) Brg1 knockdown significantly decreased the TRPM4 promoter activity. **p < 0.01 vs. Scramble-siRNA group by two-tailed Student’s t-test. n = 6 in each group. (E) Inhibited Brg1 by PFI-3 (10 μM) significantly reduced the TRPM4 promoter activity. **p < 0.01 vs. DMSO group by two-tailed Student’s t-test. n = 6 in each group. (F) RUNX1 knockdown declined the increases in TRPM4 promoter activity caused by Brg1-OE. *p < 0.05, vs. NC group; ##p < 0.01 vs. +Scramble-siRNA by (Continued)

Article Snippet: After incubation in 5% non-fat milk for 1.5 h at room temperature, the membranes were incubated at 4°C overnight with TRPM4 antibody (1:500; ABclonal Technology Co.,Ltd.), β-actin antibody (1:1000; Santa, United States), Brg1 antibody (Sigma-Aldrich, 07–478, 1:500) and RUNX1 antibody (Proteintech 25315-1-AP, 1:1000).

Techniques: Activity Assay, Residue, Immunoprecipitation, Two Tailed Test, Knockdown

FIGURE 9 A schematic diagram summarizing the potential mechanisms that Brg1 interacted with RUNX1 transcriptional regulated TRPM4, that eventually leads to TRPM4 overactivation in cardiomyocytes induced by hypoxia.

Journal: Frontiers in pharmacology

Article Title: Brg1 and RUNX1 synergy in regulating TRPM4 channel in mouse cardiomyocytes.

doi: 10.3389/fphar.2024.1494205

Figure Lengend Snippet: FIGURE 9 A schematic diagram summarizing the potential mechanisms that Brg1 interacted with RUNX1 transcriptional regulated TRPM4, that eventually leads to TRPM4 overactivation in cardiomyocytes induced by hypoxia.

Article Snippet: After incubation in 5% non-fat milk for 1.5 h at room temperature, the membranes were incubated at 4°C overnight with TRPM4 antibody (1:500; ABclonal Technology Co.,Ltd.), β-actin antibody (1:1000; Santa, United States), Brg1 antibody (Sigma-Aldrich, 07–478, 1:500) and RUNX1 antibody (Proteintech 25315-1-AP, 1:1000).

Techniques:

(A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of Runx2. *means significant difference.

Journal: PLoS ONE

Article Title: Demineralized bone matrix used for direct pulp capping in rats

doi: 10.1371/journal.pone.0172693

Figure Lengend Snippet: (A): Representative immunohistochemical images of the blank control group, the Ca(OH) 2 group and the DBM group. a: The blank control group. Pulp morphology was normal. b- f: Ca(OH) 2 group (1, 3, 7, 14, 28 days). g- k: DBM group (1, 3, 7, 14, 28 days). (B): Mean IOD value of Runx2. *means significant difference.

Article Snippet: The sections were deparaffinized with xylene, hydrated in a series of descending grades of ethanol, and then rinsed briefly with PBS for the primary antibodies; the sections were incubated overnight at 4°C with polyclonal anti- Runx2, COL I, OCN and DSP (Wuhan Boster Biological Technology, Wuhan, China).

Techniques: Immunohistochemical staining, Control

EIF3B relative expression in human AML cell lines. EIF3B mRNA relative expression (A) and protein expression (B) were increased in AML-193, OCI-AML2, and KG-1 cell lines compared to human primary BMMC. The comparison of EIF3B mRNA relative expression between human AML cell lines and human primary BMMC was conducted using one-way ANOVA followed by Dunnett’s multiple comparisons test. P < 0.05 was considered significant. NS, non-significant; *P < 0.05, **P < 0.01, ***P < 0.001. EIF3B, eukaryotic translation initiation factor 3 subunit B; AML, acute myeloid leukemia; BMMC, bone marrow mononuclear cells.

Journal: International Journal of Clinical and Experimental Pathology

Article Title: Knockdown of eukaryotic translation initiation factor 3 subunit B inhibits cell proliferation and migration and promotes apoptosis by downregulating WNT signaling pathway in acute myeloid leukemia

doi:

Figure Lengend Snippet: EIF3B relative expression in human AML cell lines. EIF3B mRNA relative expression (A) and protein expression (B) were increased in AML-193, OCI-AML2, and KG-1 cell lines compared to human primary BMMC. The comparison of EIF3B mRNA relative expression between human AML cell lines and human primary BMMC was conducted using one-way ANOVA followed by Dunnett’s multiple comparisons test. P < 0.05 was considered significant. NS, non-significant; *P < 0.05, **P < 0.01, ***P < 0.001. EIF3B, eukaryotic translation initiation factor 3 subunit B; AML, acute myeloid leukemia; BMMC, bone marrow mononuclear cells.

Article Snippet: Cell culture Human AML cell lines AML-193, HL-60, OCI-AML2 and KG-1 were purchased from Leibniz Institute DSMZ-German Collection of Microorganisms and Cell Cultures (Braunschweig, Germany), AML-193 cells were cultured in 90% Iscove’s Modified Dulbecco’s Medium (Gibco, USA) and 10% fetal bovine serum (FBS) (Gibco, USA), and HL-60, OCI-AML2 and KG-1 cells were cultured in 90% Roswell Park Memorial Institute 1640 Medium (Gibco, USA) and 10% FBS (Gibco, USA) under 95% air and 5% CO 2 at 37°C.

Techniques: Expressing, Comparison

Fig. 1. The population sizes of TRKB+ and TRKC+ neurons are altered in the P0 miRCKO mice. (A-C) The percentage of TRKB+ neurons was increased in the miRCKO mice. Immunostaining for TRKB on DRG sections of control Wnt1-Cre mice (A) and the miRCKO mice (B) as well as quantification of the percentage of TRKB+ neurons in L3-L5 ganglions (C, n=3, 4). (D) The number of total neurons (ISL1+) in L5 DRG was not altered in the miRCKO mice compared with controls (n=3, 4; not significant). (E-G) The percent of total TRKC neurons were decreased in the miRCKO mice. Double immunostaining for TRKC and RUNX3 on DRG sections of Wnt1-Cre mice (E) and miR CKO mice (F), arrow heads in E and F point to NF3 (TRKC+RUNX3-) neurons, inset are higher magnifications of areas outlined in E and F. (G) Quantification of the percentage of total TRKC, TRKC+RUNX3+ (not significant) and TRKC+RUNX3- neurons in L3-L5 ganglions (n=4, 4). Data shown in mean±s.e.m. and analyzed by t-test and P<0.05 is statistically significant. *P<0.05, **P<0.01. Scale bar =µ.

Journal: Development (Cambridge, England)

Article Title: Termination of cell-type specification gene programs by the miR-183 cluster determines the population sizes of low-threshold mechanosensitive neurons.

doi: 10.1242/dev.165613

Figure Lengend Snippet: Fig. 1. The population sizes of TRKB+ and TRKC+ neurons are altered in the P0 miRCKO mice. (A-C) The percentage of TRKB+ neurons was increased in the miRCKO mice. Immunostaining for TRKB on DRG sections of control Wnt1-Cre mice (A) and the miRCKO mice (B) as well as quantification of the percentage of TRKB+ neurons in L3-L5 ganglions (C, n=3, 4). (D) The number of total neurons (ISL1+) in L5 DRG was not altered in the miRCKO mice compared with controls (n=3, 4; not significant). (E-G) The percent of total TRKC neurons were decreased in the miRCKO mice. Double immunostaining for TRKC and RUNX3 on DRG sections of Wnt1-Cre mice (E) and miR CKO mice (F), arrow heads in E and F point to NF3 (TRKC+RUNX3-) neurons, inset are higher magnifications of areas outlined in E and F. (G) Quantification of the percentage of total TRKC, TRKC+RUNX3+ (not significant) and TRKC+RUNX3- neurons in L3-L5 ganglions (n=4, 4). Data shown in mean±s.e.m. and analyzed by t-test and P<0.05 is statistically significant. *P<0.05, **P<0.01. Scale bar =µ.

Article Snippet: The following primary antibodies were used: mouse antibodies against ISL1 (DSHB, USA, 1:100), SHOX2 (Santa Cruz, USA, 1:400), NFH (neurofilament, heavy polypeptide) (CloneN52; Sigma-aldrich, St. Louis, MO, USA, 1:500); rabbit antibodies against RUNX3 (gifts from Thomas Jessell, Columbia University Medical Center, 1:300), ISL1 (gifts from Thomas Jessell, Columbia University Medical Center, 1:250), NFH (Millipore, USA, 1:200), TRKA (Millipore, USA, 1:500), TRKC (Cell signaling, USA, 1:500), NECAB2 (Proteintech Europe, 1:1000), CALB1 (Millipore, USA, 1:500) and chicken-TRKB (kind gift from Louis F. Reichardt, 1:2000); goat antibodies against TRKA (R&D systems, Minneapolis, MN, USA, 1:500), TRKB (R&D systems, Minneapolis, MN, USA, 1:500), TRKC (R&D, 1:500), Ret (R&D, 1:100) and GFP (Abcam, USA, 1:500); Guinea pig antibodies against TLX3 (kind gift from Carmen Birchmeier).

Techniques: Immunostaining, Control, Double Immunostaining

Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 5. Re‑identification of altenation of runt‑related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (x100) of immunohistochemical analysis of (a‑d) control samples and (e‑h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β‑actin as an internal control. A significant decrease in a time‑dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Immunohistochemistry, Western Blot, Immunohistochemical staining, Control, Expressing, Staining

Figure 4. Identification of alteration of runt‑related transcription factor 1 (RUNX1) protein expression by MALDI‑TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss‑Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identi fied as RUNX1. Inset is the Swiss‑Prot protein score from the Swiss‑Prot database.

Journal: International journal of molecular medicine

Article Title: Brain death induces the alteration of liver protein expression profiles in rabbits.

doi: 10.3892/ijmm.2014.1806

Figure Lengend Snippet: Figure 4. Identification of alteration of runt‑related transcription factor 1 (RUNX1) protein expression by MALDI‑TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss‑Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identi fied as RUNX1. Inset is the Swiss‑Prot protein score from the Swiss‑Prot database.

Article Snippet: The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.).

Techniques: Expressing, Mass Spectrometry, Tandem Mass Spectroscopy