BAAT antibody was raised using the N terminal of BAAT corresponding to a region with amino acids IQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHYR. Rabbit polyclonal BAAT antibody raised against the N terminal of BAAT.

This strain is part of the Global Priority Superbugs collection. It is an extensively characterized antimicrobial-resistant clinical isolate with validated genotypic and phenotypic activity against a variety of drug classes. This strain is provided with