anti ikk β antibodies  (Novus Biologicals)

 
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 86
    Name:
    IKK beta Antibody 3C12
    Description:
    The IKK beta Antibody 3C12 from Novus Biologicals is a mouse monoclonal antibody to IKK beta This antibody reacts with human The IKK beta Antibody 3C12 has been validated for the following applications Western Blot ELISA Immunocytochemistry Immunofluorescence
    Catalog Number:
    h00003551-m08
    Price:
    379
    Host:
    Mouse
    Purity:
    IgG purified
    Conjugate:
    Unconjugated
    Immunogen:
    IKBKB (AAH06231 3 a.a. - 120 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
    Size:
    0 1 mg
    Category:
    Primary Antibodies
    Isotype:
    IgG2b Kappa
    Buy from Supplier


    Structured Review

    Novus Biologicals anti ikk β antibodies
    IKK beta Antibody 3C12
    The IKK beta Antibody 3C12 from Novus Biologicals is a mouse monoclonal antibody to IKK beta This antibody reacts with human The IKK beta Antibody 3C12 has been validated for the following applications Western Blot ELISA Immunocytochemistry Immunofluorescence
    https://www.bioz.com/result/anti ikk β antibodies/product/Novus Biologicals
    Average 86 stars, based on 8 article reviews
    Price from $9.99 to $1999.99
    anti ikk β antibodies - by Bioz Stars, 2020-09
    86/100 stars

    Images

    1) Product Images from "Curcumin Modulates Nuclear Factor ?B (NF-?B)-mediated Inflammation in Human Tenocytes in Vitro"

    Article Title: Curcumin Modulates Nuclear Factor ?B (NF-?B)-mediated Inflammation in Human Tenocytes in Vitro

    Journal: The Journal of Biological Chemistry

    doi: 10.1074/jbc.M111.256180

    A, effects of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved primary human tenocytes were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and then co-treated with IL-1β (10 ng/ml) for the indicated times. Whole cell extracts were immunoprecipitated with an antibody against IκB kinase (IKK)-α and analyzed by an immune complex kinase assay. To examine the effect of curcumin on the expression level of IKK proteins, whole cell extracts (500 ng of protein/lane) were fractionated by SDS-PAGE and examined using Western blot analysis with anti-IKK-α and anti-IKK-β antibodies. Data shown are representative of three independent experiments. B, direct effect of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were treated with 10 ng/ml of IL-1β. Whole cell extracts were prepared and immunoprecipitated with anti-IKK-α antibody. The immunocomplex kinase assay was performed in the absence or presence of curcumin at the indicated concentrations. Data shown are representative of three independent experiments.
    Figure Legend Snippet: A, effects of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved primary human tenocytes were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and then co-treated with IL-1β (10 ng/ml) for the indicated times. Whole cell extracts were immunoprecipitated with an antibody against IκB kinase (IKK)-α and analyzed by an immune complex kinase assay. To examine the effect of curcumin on the expression level of IKK proteins, whole cell extracts (500 ng of protein/lane) were fractionated by SDS-PAGE and examined using Western blot analysis with anti-IKK-α and anti-IKK-β antibodies. Data shown are representative of three independent experiments. B, direct effect of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were treated with 10 ng/ml of IL-1β. Whole cell extracts were prepared and immunoprecipitated with anti-IKK-α antibody. The immunocomplex kinase assay was performed in the absence or presence of curcumin at the indicated concentrations. Data shown are representative of three independent experiments.

    Techniques Used: Activation Assay, Immunoprecipitation, Immune Complex Kinase Assay, Expressing, SDS Page, Western Blot, Kinase Assay

    2) Product Images from "Curcumin Enhances the Effect of Chemotherapy against Colorectal Cancer Cells by Inhibition of NF-?B and Src Protein Kinase Signaling Pathways"

    Article Title: Curcumin Enhances the Effect of Chemotherapy against Colorectal Cancer Cells by Inhibition of NF-?B and Src Protein Kinase Signaling Pathways

    Journal: PLoS ONE

    doi: 10.1371/journal.pone.0057218

    Effect of 5-FU and/or curcumin or PI-3K inhibitor wortmannin on activation of IκBα kinase (IKK) in HCT116 and HCT116+ch3 colon cancer cells. A: HCT116 cells were treated with 5-FU (5 µM) for 0, 5, 10, 20, 40, or 60 minutes or were pretreated with curcumin (5 µM) or wortmannin (10 nM) for 1 h and then co-treated with 1 µM 5-FU for 0, 5, 10, 20, 40, or 60 minutes. B: HCT116+ch3 cells were treated with 5-FU (1 µM) for 0, 5, 10, 20, 40, or 60 minutes or were pretreated with curcumin (5 µM) or wortmannin (10 nM) for 1 h and then co-treated with 0.1 µM 5-FU for 0, 5, 10, 20, 40, or 60 minutes. Cells were lysed and immune complex kinase assays were performed as described in Materials and Methods. Equal amounts of total protein (500 ng protein per lane) were separated by SDS-PAGE under reducing conditions and then analyzed by immunoblotting using antibodies against phosphospecific IκBα (lane I), IKK-α (lane II), and IKK-β (lane III).
    Figure Legend Snippet: Effect of 5-FU and/or curcumin or PI-3K inhibitor wortmannin on activation of IκBα kinase (IKK) in HCT116 and HCT116+ch3 colon cancer cells. A: HCT116 cells were treated with 5-FU (5 µM) for 0, 5, 10, 20, 40, or 60 minutes or were pretreated with curcumin (5 µM) or wortmannin (10 nM) for 1 h and then co-treated with 1 µM 5-FU for 0, 5, 10, 20, 40, or 60 minutes. B: HCT116+ch3 cells were treated with 5-FU (1 µM) for 0, 5, 10, 20, 40, or 60 minutes or were pretreated with curcumin (5 µM) or wortmannin (10 nM) for 1 h and then co-treated with 0.1 µM 5-FU for 0, 5, 10, 20, 40, or 60 minutes. Cells were lysed and immune complex kinase assays were performed as described in Materials and Methods. Equal amounts of total protein (500 ng protein per lane) were separated by SDS-PAGE under reducing conditions and then analyzed by immunoblotting using antibodies against phosphospecific IκBα (lane I), IKK-α (lane II), and IKK-β (lane III).

    Techniques Used: Activation Assay, Immune Complex Kinase Assay, SDS Page

    3) Product Images from "Curcumin Modulates Nuclear Factor ?B (NF-?B)-mediated Inflammation in Human Tenocytes in Vitro"

    Article Title: Curcumin Modulates Nuclear Factor ?B (NF-?B)-mediated Inflammation in Human Tenocytes in Vitro

    Journal: The Journal of Biological Chemistry

    doi: 10.1074/jbc.M111.256180

    A, effects of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved primary human tenocytes were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and then co-treated with IL-1β (10 ng/ml) for the indicated times. Whole cell extracts were immunoprecipitated with an antibody against IκB kinase (IKK)-α and analyzed by an immune complex kinase assay. To examine the effect of curcumin on the expression level of IKK proteins, whole cell extracts (500 ng of protein/lane) were fractionated by SDS-PAGE and examined using Western blot analysis with anti-IKK-α and anti-IKK-β antibodies. Data shown are representative of three independent experiments. B, direct effect of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were treated with 10 ng/ml of IL-1β. Whole cell extracts were prepared and immunoprecipitated with anti-IKK-α antibody. The immunocomplex kinase assay was performed in the absence or presence of curcumin at the indicated concentrations. Data shown are representative of three independent experiments.
    Figure Legend Snippet: A, effects of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved primary human tenocytes were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and then co-treated with IL-1β (10 ng/ml) for the indicated times. Whole cell extracts were immunoprecipitated with an antibody against IκB kinase (IKK)-α and analyzed by an immune complex kinase assay. To examine the effect of curcumin on the expression level of IKK proteins, whole cell extracts (500 ng of protein/lane) were fractionated by SDS-PAGE and examined using Western blot analysis with anti-IKK-α and anti-IKK-β antibodies. Data shown are representative of three independent experiments. B, direct effect of curcumin treatment on IL-1β-induced IκB kinase activation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were treated with 10 ng/ml of IL-1β. Whole cell extracts were prepared and immunoprecipitated with anti-IKK-α antibody. The immunocomplex kinase assay was performed in the absence or presence of curcumin at the indicated concentrations. Data shown are representative of three independent experiments.

    Techniques Used: Activation Assay, Immunoprecipitation, Immune Complex Kinase Assay, Expressing, SDS Page, Western Blot, Kinase Assay

    Effect of curcumin on IL-1β-induced Akt phosphorylation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and exposed to 10 ng/ml of IL-1β for the indicated times. Whole cell extracts were analyzed by Western blot analysis using anti-phospho-specific Akt ( row I ). Cell extracts were immunoprecipitated ( IP ) with anti-IKK-α antibody and the immunoprecipitates were separated (500 ng of protein/lane) by SDS-PAGE and analyzed by immunoblotting ( IB ) using anti-Akt antibody ( row II ) or with anti-IKK-α antibody ( row III , as a loading control). Results shown are representative of three independent experiments.
    Figure Legend Snippet: Effect of curcumin on IL-1β-induced Akt phosphorylation. Serum-starved human tenocytes (1 × 10 6 cells/ml) were either stimulated with 10 ng/ml of IL-1β for the indicated times or pre-treated with 5 μ m curcumin for 4 h and exposed to 10 ng/ml of IL-1β for the indicated times. Whole cell extracts were analyzed by Western blot analysis using anti-phospho-specific Akt ( row I ). Cell extracts were immunoprecipitated ( IP ) with anti-IKK-α antibody and the immunoprecipitates were separated (500 ng of protein/lane) by SDS-PAGE and analyzed by immunoblotting ( IB ) using anti-Akt antibody ( row II ) or with anti-IKK-α antibody ( row III , as a loading control). Results shown are representative of three independent experiments.

    Techniques Used: Western Blot, Immunoprecipitation, SDS Page

    4) Product Images from "Equilin in conjugated equine estrogen increases monocyte-endothelial adhesion via NF-κB signaling"

    Article Title: Equilin in conjugated equine estrogen increases monocyte-endothelial adhesion via NF-κB signaling

    Journal: PLoS ONE

    doi: 10.1371/journal.pone.0211462

    Effect of Eq treatment on the NF-κB-signaling pathway in HUVECs and differential expression of adhesion molecules in HUVECs following treatment with p65-specific or control siRNA. HUVECs were treated with 1 nmol/L E2 or Eq. ( A ) Effects of Eq on the expression of proteins involved in the NF-κB-signaling pathway (ERβ, HIF-1α, IKKβ, IκBα, and phosphorylated-IκBα) were evaluated by western blotting. ( B ) Concentrations of the p65 NF-κB subunit were measured in purified cytoplasmic or nuclear extracts by western blotting. ( C ) Representative images of immunofluorescence analysis of p65 localization in HUVECs at 200× magnification ( left ). The nuclear architecture is shown by 4′,6-diamidino-2-phenylindole staining ( middle ). All experiments were performed in triplicate with comparable results. Relative mRNA expression of genes encoding ( D ) E-selectin, ( E ) ICAM-1, ( F ) P-selectin, and ( G ) VCAM-1 in HUVECs transiently transfected for 24 or 48 hours with scrambled (control) or p65-specific siRNA and treated for 24 hours with or without 1 nmol/L E2 or Eq. Data are expressed as the mean ± SEM of three experiments involving assays performed in triplicate. * P
    Figure Legend Snippet: Effect of Eq treatment on the NF-κB-signaling pathway in HUVECs and differential expression of adhesion molecules in HUVECs following treatment with p65-specific or control siRNA. HUVECs were treated with 1 nmol/L E2 or Eq. ( A ) Effects of Eq on the expression of proteins involved in the NF-κB-signaling pathway (ERβ, HIF-1α, IKKβ, IκBα, and phosphorylated-IκBα) were evaluated by western blotting. ( B ) Concentrations of the p65 NF-κB subunit were measured in purified cytoplasmic or nuclear extracts by western blotting. ( C ) Representative images of immunofluorescence analysis of p65 localization in HUVECs at 200× magnification ( left ). The nuclear architecture is shown by 4′,6-diamidino-2-phenylindole staining ( middle ). All experiments were performed in triplicate with comparable results. Relative mRNA expression of genes encoding ( D ) E-selectin, ( E ) ICAM-1, ( F ) P-selectin, and ( G ) VCAM-1 in HUVECs transiently transfected for 24 or 48 hours with scrambled (control) or p65-specific siRNA and treated for 24 hours with or without 1 nmol/L E2 or Eq. Data are expressed as the mean ± SEM of three experiments involving assays performed in triplicate. * P

    Techniques Used: Expressing, Western Blot, Purification, Immunofluorescence, Staining, Transfection

    Related Articles

    other:

    Article Title: IGF-1 and PDGF-bb Suppress IL-1?-Induced Cartilage Degradation through Down-Regulation of NF-?B Signaling: Involvement of Src/PI-3K/AKT Pathway
    Article Snippet: Anti-IκBα kinase (IKK)-α and anti-IKK-β antibodies were obtained from Imgenex (Germany).

    Similar Products

  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 91
    Novus Biologicals iκb kinase ikk β
    Iκb Kinase Ikk β, supplied by Novus Biologicals, used in various techniques. Bioz Stars score: 91/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/iκb kinase ikk β/product/Novus Biologicals
    Average 91 stars, based on 1 article reviews
    Price from $9.99 to $1999.99
    iκb kinase ikk β - by Bioz Stars, 2020-09
    91/100 stars
      Buy from Supplier

    Image Search Results