biotinylated proteins  (RayBiotech)


Bioz Verified Symbol RayBiotech is a verified supplier
Bioz Manufacturer Symbol RayBiotech manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 88

    Structured Review

    RayBiotech biotinylated proteins
    L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound <t>biotinylated</t> proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.
    Biotinylated Proteins, supplied by RayBiotech, used in various techniques. Bioz Stars score: 88/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/biotinylated proteins/product/RayBiotech
    Average 88 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    biotinylated proteins - by Bioz Stars, 2020-07
    88/100 stars

    Images

    1) Product Images from "Development of ‘Redox Arrays’ for identifying novel glutathionylated proteins in the secretome"

    Article Title: Development of ‘Redox Arrays’ for identifying novel glutathionylated proteins in the secretome

    Journal: Scientific Reports

    doi: 10.1038/srep14630

    L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound biotinylated proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.
    Figure Legend Snippet: L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound biotinylated proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.

    Techniques Used: Positive Control

    Similar Products

  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
  • 88
    RayBiotech biotinylated proteins
    L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound <t>biotinylated</t> proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.
    Biotinylated Proteins, supplied by RayBiotech, used in various techniques. Bioz Stars score: 88/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/biotinylated proteins/product/RayBiotech
    Average 88 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    biotinylated proteins - by Bioz Stars, 2020-07
    88/100 stars
      Buy from Supplier

    91
    RayBiotech biotinylated peptides
    Scheme of the protocol followed for the high throughput analysis of the interactome of the tetraspanin-enriched microdomains. A , <t>biotinylated,</t> synthetic peptides containing the intracellular regions (C-terminal in all cases except for CD69) of tetraspanins CD9, CD81(depicted in the figure), and CD151, their associated receptors (EWI-2, ICAM-1, and VCAM-1), or different control receptors (CD147, CD69, ICAM-3, CCR7, and CXCR4) were bound to streptavidin-Sepharose beads and incubated with protein extracts from whole cell lysates or exosomes from human primary lymphoblasts. Beads were washed and directly subjected to concentrating SDS-PAGE. Protein bands were trypsin-digested, and the resulting peptides were identified by liquid chromatography in tandem with linear ion trap mass spectrometry. B , peptide counting analysis reveals specific protein interactions with peptide baits. The left plot represents the distribution of the number of peptides identified per each protein in a representative pulldown assay. On the right , the number of peptides from the proteins is indicated by the arrows , which show specific interactions with one or more baits are shown.
    Biotinylated Peptides, supplied by RayBiotech, used in various techniques. Bioz Stars score: 91/100, based on 2 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/result/biotinylated peptides/product/RayBiotech
    Average 91 stars, based on 2 article reviews
    Price from $9.99 to $1999.99
    biotinylated peptides - by Bioz Stars, 2020-07
    91/100 stars
      Buy from Supplier

    Image Search Results


    L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound biotinylated proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.

    Journal: Scientific Reports

    Article Title: Development of ‘Redox Arrays’ for identifying novel glutathionylated proteins in the secretome

    doi: 10.1038/srep14630

    Figure Lengend Snippet: L1000 antibody arrays (composed of L507 on the left and L493 on the right) identify a number of glutathionylated proteins secreted from LPS-treated THP-1 cells. ( a ) Conditioned media from LPS-treated BioGEE-loaded THP-1 cells were applied to the array. Streptavidin-HRP was used to detect the presence of bound biotinylated proteins. Triplicate positive control spots are indicated by arrows. ( b ) A second aliquot of the same sample was reduced with DTT and applied to a second array.

    Article Snippet: After washing, biotinylated proteins were detected according to the manufacturer’s instructions (Ray Biotech) using Streptavidin-HRP and ECL reagent.

    Techniques: Positive Control

    Scheme of the protocol followed for the high throughput analysis of the interactome of the tetraspanin-enriched microdomains. A , biotinylated, synthetic peptides containing the intracellular regions (C-terminal in all cases except for CD69) of tetraspanins CD9, CD81(depicted in the figure), and CD151, their associated receptors (EWI-2, ICAM-1, and VCAM-1), or different control receptors (CD147, CD69, ICAM-3, CCR7, and CXCR4) were bound to streptavidin-Sepharose beads and incubated with protein extracts from whole cell lysates or exosomes from human primary lymphoblasts. Beads were washed and directly subjected to concentrating SDS-PAGE. Protein bands were trypsin-digested, and the resulting peptides were identified by liquid chromatography in tandem with linear ion trap mass spectrometry. B , peptide counting analysis reveals specific protein interactions with peptide baits. The left plot represents the distribution of the number of peptides identified per each protein in a representative pulldown assay. On the right , the number of peptides from the proteins is indicated by the arrows , which show specific interactions with one or more baits are shown.

    Journal: The Journal of Biological Chemistry

    Article Title: The Intracellular Interactome of Tetraspanin-enriched Microdomains Reveals Their Function as Sorting Machineries toward Exosomes *

    doi: 10.1074/jbc.M112.445304

    Figure Lengend Snippet: Scheme of the protocol followed for the high throughput analysis of the interactome of the tetraspanin-enriched microdomains. A , biotinylated, synthetic peptides containing the intracellular regions (C-terminal in all cases except for CD69) of tetraspanins CD9, CD81(depicted in the figure), and CD151, their associated receptors (EWI-2, ICAM-1, and VCAM-1), or different control receptors (CD147, CD69, ICAM-3, CCR7, and CXCR4) were bound to streptavidin-Sepharose beads and incubated with protein extracts from whole cell lysates or exosomes from human primary lymphoblasts. Beads were washed and directly subjected to concentrating SDS-PAGE. Protein bands were trypsin-digested, and the resulting peptides were identified by liquid chromatography in tandem with linear ion trap mass spectrometry. B , peptide counting analysis reveals specific protein interactions with peptide baits. The left plot represents the distribution of the number of peptides identified per each protein in a representative pulldown assay. On the right , the number of peptides from the proteins is indicated by the arrows , which show specific interactions with one or more baits are shown.

    Article Snippet: Biotinylated peptides with the following sequences were obtained from Ray Biotech, Inc. (Norcross, GA): CD147, biotin-SGSG-KRRKPDQTLDEDDPGAAPLKGSGHHMNDKDKNRQRNAT; CD69, MSSENCFVAENSSLHPESGQENDATSPHFSTRHEGSFQ-GSGSK-biotin; CD151, biotin-SGSG-YRSLKLEHY; CD81, biotin-SGSG-CCGIRNSSVY; EWI-2, biotin-SGSG-CCFMKRLRKR; ICAM-1, biotin-SGSG-RQRKIKKYRLQQAQKGTPMKPNTQATPP; VCAM-1, biotin-SGSG-RKANMKGSYSLVEAQKSKV; ICAM-3, biotin-REHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE; CD9, biotin-SGSG-CCAIRRNREMV; CCR7, biotin-KFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP; CXCR4, biotin-KFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS.

    Techniques: High Throughput Screening Assay, Incubation, SDS Page, Liquid Chromatography, Mass Spectrometry

    The C-terminal domain of CD81 mediates its association with SAMHD1. a) SAMHD1 immunoblot of primary T lymphoblast lysates pulled-down with biotinylated peptides of tetraspanins CD81, CD9 and CD151 C-terminal domains. Sepharose-negative control and whole cell lysate are shown. b) Primary T lymphoblast lysates were immunoprecipitated and immunoblotted with SAMHD1 or CD81 antibodies. Control beads incubated with cell lysate, and whole cell lysate are shown. c) Hela/R5 cells or primary T lymphoblasts were plated onto PLL, fixed, permeabilized in PBS 0.5% Triton X-100 for 5 min, stained for CD81 (red) and SAMHD1 (green), and analysed by confocal microscopy. One single confocal plane is shown, nuclei are in blue. Bar = 10μm. d) Hela/R5 cells transfected with control siRNA (siControl) or CD81 siRNA (siCD81) were plated onto PLL (10μg/ml), anti-CD9 (VJ1/20, 10μg/ml), anti-CD4 (HP2/6, 10μg/ml) or anti-CD81 (5A6, 10μg/ml) monoclonal antibodies for 2h, fixed, permeabilized in 0.5% Triton X-100 for 5min, and stained for SAMHD1 (polyclonal antibody). Images show a single confocal plane at a ventral position, bar = 10μm. Graph shows means ± SEM of the number (counts/cell) of SAMHD1 + clusters (n=50 cells, 3 independent experiments), analysed by one-way ANOVA with Tukey’s post-test. e) Duo-link immunoassay of primary T lymphoblasts plated onto PLL, permeabilized in PBS 0.5% Triton X-100 for 5min, and stained for SAMHD1 and CD81. SAMHD1/CD147 and CD81/ERM were used as negative and positive controls respectively, bar = 10μm. Graph shows the number of dots per cell; each dot represents a single cell, bars denote the mean of scatter plots, and data was analysed by one-way ANOVA with Dunns post-test.

    Journal: Nature microbiology

    Article Title: CD81 association with SAMHD1 enhances HIV-1 reverse transcription by increasing dNTP levels

    doi: 10.1038/s41564-017-0019-0

    Figure Lengend Snippet: The C-terminal domain of CD81 mediates its association with SAMHD1. a) SAMHD1 immunoblot of primary T lymphoblast lysates pulled-down with biotinylated peptides of tetraspanins CD81, CD9 and CD151 C-terminal domains. Sepharose-negative control and whole cell lysate are shown. b) Primary T lymphoblast lysates were immunoprecipitated and immunoblotted with SAMHD1 or CD81 antibodies. Control beads incubated with cell lysate, and whole cell lysate are shown. c) Hela/R5 cells or primary T lymphoblasts were plated onto PLL, fixed, permeabilized in PBS 0.5% Triton X-100 for 5 min, stained for CD81 (red) and SAMHD1 (green), and analysed by confocal microscopy. One single confocal plane is shown, nuclei are in blue. Bar = 10μm. d) Hela/R5 cells transfected with control siRNA (siControl) or CD81 siRNA (siCD81) were plated onto PLL (10μg/ml), anti-CD9 (VJ1/20, 10μg/ml), anti-CD4 (HP2/6, 10μg/ml) or anti-CD81 (5A6, 10μg/ml) monoclonal antibodies for 2h, fixed, permeabilized in 0.5% Triton X-100 for 5min, and stained for SAMHD1 (polyclonal antibody). Images show a single confocal plane at a ventral position, bar = 10μm. Graph shows means ± SEM of the number (counts/cell) of SAMHD1 + clusters (n=50 cells, 3 independent experiments), analysed by one-way ANOVA with Tukey’s post-test. e) Duo-link immunoassay of primary T lymphoblasts plated onto PLL, permeabilized in PBS 0.5% Triton X-100 for 5min, and stained for SAMHD1 and CD81. SAMHD1/CD147 and CD81/ERM were used as negative and positive controls respectively, bar = 10μm. Graph shows the number of dots per cell; each dot represents a single cell, bars denote the mean of scatter plots, and data was analysed by one-way ANOVA with Dunns post-test.

    Article Snippet: N-terminally biotinylated peptides containing a SGSG linker sequence connected to the cytoplasmic C-terminal domains of the proteins of interest were purchased from Ray Biotech, and have been previously described , .

    Techniques: Negative Control, Immunoprecipitation, Incubation, Staining, Confocal Microscopy, Transfection