Review




Structured Review

Valiant Co Ltd nisin
Nisin, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 96/100, based on 57 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/0215583905/Nisin/pmc12453121-10-0-13
Average 96 stars, based on 57 article reviews
nisin - by Bioz Stars, 2026-09
96/100 stars

Images

Related Articles

Activity Assay:

Article Title: Strategies for effective high pressure germination or inactivation of Bacillus spores involving nisin
Article Snippet: .. The nisin stock contained 25,000 IU/mL commercial nisin [2.5% nisin A, 75% sodium chloride, and 22.5% denatured milk solids (% in wt/wt), nisin activity 1,052 IU/mg of the commercial product, REF 155839, MP Biomedicals, USA] dissolved in sterile-filtered 0.02 M HCl (0.2 μm, glass fiber cellulose acetate filter, Minisart, Sartorius). ..

Sterility:

Article Title: Strategies for effective high pressure germination or inactivation of Bacillus spores involving nisin
Article Snippet: .. The nisin stock contained 25,000 IU/mL commercial nisin [2.5% nisin A, 75% sodium chloride, and 22.5% denatured milk solids (% in wt/wt), nisin activity 1,052 IU/mg of the commercial product, REF 155839, MP Biomedicals, USA] dissolved in sterile-filtered 0.02 M HCl (0.2 μm, glass fiber cellulose acetate filter, Minisart, Sartorius). ..

Membrane:

Article Title: The combined effects of tick defensin persulcatusin with conventional antibiotics and antimicrobial proteins/peptides against Staphylococcus aureus
Article Snippet: Ciprofloxacin , Quinolones , Inhibitor of DNA biosynthesis , FUJIFILM Wako Pure Chemical Corporation, Osaka, Japan. .. Nisin , Lantibiotics , Membrane damage and inhibition of cell wall biosynthesis , MP Biomedicals, LLC, Irvine, CA, USA. .. Bacitracin , Polypeptide , Inhibition of cell wall biosynthesis , Sigma-Aldrich, St. Louis, MO, USA.

Inhibition:

Article Title: The combined effects of tick defensin persulcatusin with conventional antibiotics and antimicrobial proteins/peptides against Staphylococcus aureus
Article Snippet: Ciprofloxacin , Quinolones , Inhibitor of DNA biosynthesis , FUJIFILM Wako Pure Chemical Corporation, Osaka, Japan. .. Nisin , Lantibiotics , Membrane damage and inhibition of cell wall biosynthesis , MP Biomedicals, LLC, Irvine, CA, USA. .. Bacitracin , Polypeptide , Inhibition of cell wall biosynthesis , Sigma-Aldrich, St. Louis, MO, USA.



Similar Products

96
Valiant Co Ltd nisin
Nisin, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/0215583905/Nisin/pmc12772383-207-24-26
Average 96 stars, based on 1 article reviews
nisin - by Bioz Stars, 2026-09
96/100 stars
  Buy from Supplier

96
Valiant Co Ltd nisin stock
Nisin Stock, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/0215583905/Nisin/pmc11505639-287-1-32
Average 96 stars, based on 1 article reviews
nisin stock - by Bioz Stars, 2026-09
96/100 stars
  Buy from Supplier

96
Valiant Co Ltd nisin activity
Nisin Activity, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/0215583905/Nisin/pmc11505639-287-22-32
Average 96 stars, based on 1 article reviews
nisin activity - by Bioz Stars, 2026-09
96/100 stars
  Buy from Supplier

96
Valiant Co Ltd lantibiotic peptide nisin
MICs of antimicrobial agents against IP-susceptible Tn-insertion mutants.
Lantibiotic Peptide Nisin, supplied by Valiant Co Ltd, used in various techniques. Bioz Stars score: 96/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/0215583905/Nisin/pmc10892762-57-23-26
Average 96 stars, based on 1 article reviews
lantibiotic peptide nisin - by Bioz Stars, 2026-09
96/100 stars
  Buy from Supplier

Image Search Results


MICs of antimicrobial agents against IP-susceptible Tn-insertion mutants.

Journal: Microorganisms

Article Title: Identification of Genes Associated with Resistance to Persulcatusin, a Tick Defensin from Ixodes persulcatus

doi: 10.3390/microorganisms12020412

Figure Lengend Snippet: MICs of antimicrobial agents against IP-susceptible Tn-insertion mutants.

Article Snippet: The AMPs used in this study included IP (GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR [ ]), bLfinB (FKCRRWQWRMKKLGAPSITCVRRAF [ ]), which was derived from pepsin-digested bovine lactoferrin, the lantibiotic peptide nisin (MP Biomedicals, Santa Ana, CA, USA) and the lipopeptide daptomycin (Tokyo Chemical Industry, Tokyo, Japan).

Techniques: